BLASTX nr result
ID: Scutellaria24_contig00018509
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00018509 (332 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517888.1| protein binding protein, putative [Ricinus c... 90 2e-16 ref|XP_002274722.1| PREDICTED: uncharacterized RING finger prote... 83 2e-14 ref|XP_004167319.1| PREDICTED: uncharacterized protein LOC101226... 80 1e-13 ref|XP_004149272.1| PREDICTED: DSC E3 ubiquitin ligase complex s... 80 1e-13 ref|XP_003527424.1| PREDICTED: uncharacterized RING finger prote... 77 2e-12 >ref|XP_002517888.1| protein binding protein, putative [Ricinus communis] gi|223542870|gb|EEF44406.1| protein binding protein, putative [Ricinus communis] Length = 570 Score = 89.7 bits (221), Expect = 2e-16 Identities = 39/64 (60%), Positives = 53/64 (82%), Gaps = 1/64 (1%) Frame = +2 Query: 143 LSILFRLVFGLCFIYLAIWPVNGLRPLRQR-RSWGEEWLPLGKEEQELGPFSSWNITGTY 319 L +F+LVFGL F ++ + PV G+RPL++R RSWG+EWL + K+E +LGPFS+WNITGTY Sbjct: 18 LGFVFKLVFGLWFGFVVLRPVAGVRPLKERARSWGDEWLFVKKDENDLGPFSAWNITGTY 77 Query: 320 RGNW 331 RG+W Sbjct: 78 RGSW 81 >ref|XP_002274722.1| PREDICTED: uncharacterized RING finger protein C947.10 [Vitis vinifera] gi|302143312|emb|CBI21873.3| unnamed protein product [Vitis vinifera] Length = 570 Score = 83.2 bits (204), Expect = 2e-14 Identities = 39/76 (51%), Positives = 49/76 (64%), Gaps = 1/76 (1%) Frame = +2 Query: 107 SSEMGSMKSLNLLSILFRLVFGLCFIYLAIWPVNGLRPLRQR-RSWGEEWLPLGKEEQEL 283 ++E G L FR+V GL + + PV GLRPLR R SWG+EWL + K+E L Sbjct: 6 NAEFGWFGRRGRLGFAFRVVLGLWVVLAVLRPVTGLRPLRDRAHSWGDEWLYIRKDENAL 65 Query: 284 GPFSSWNITGTYRGNW 331 GPFS WNITGTY+G+W Sbjct: 66 GPFSYWNITGTYKGSW 81 >ref|XP_004167319.1| PREDICTED: uncharacterized protein LOC101226239, partial [Cucumis sativus] Length = 291 Score = 80.5 bits (197), Expect = 1e-13 Identities = 37/58 (63%), Positives = 46/58 (79%), Gaps = 2/58 (3%) Frame = +2 Query: 164 VFGLCFIY-LAIWPVNGLRPLRQR-RSWGEEWLPLGKEEQELGPFSSWNITGTYRGNW 331 V LC ++ L PV+GLRPLR+R RSWG+EWL + K++ ELGPFS WNITGTYRG+W Sbjct: 24 VIALCVVHCLVSQPVDGLRPLRERARSWGDEWLFVTKDKSELGPFSEWNITGTYRGSW 81 >ref|XP_004149272.1| PREDICTED: DSC E3 ubiquitin ligase complex subunit 1-like [Cucumis sativus] Length = 570 Score = 80.5 bits (197), Expect = 1e-13 Identities = 37/58 (63%), Positives = 46/58 (79%), Gaps = 2/58 (3%) Frame = +2 Query: 164 VFGLCFIY-LAIWPVNGLRPLRQR-RSWGEEWLPLGKEEQELGPFSSWNITGTYRGNW 331 V LC ++ L PV+GLRPLR+R RSWG+EWL + K++ ELGPFS WNITGTYRG+W Sbjct: 24 VIALCVVHCLVSQPVDGLRPLRERARSWGDEWLFVTKDKSELGPFSEWNITGTYRGSW 81 >ref|XP_003527424.1| PREDICTED: uncharacterized RING finger protein C947.10-like [Glycine max] Length = 575 Score = 76.6 bits (187), Expect = 2e-12 Identities = 36/64 (56%), Positives = 43/64 (67%), Gaps = 1/64 (1%) Frame = +2 Query: 143 LSILFRLVFGLCFIYLAIWPVNGLRPLRQR-RSWGEEWLPLGKEEQELGPFSSWNITGTY 319 + IL R+ G L PV GLRPLR R SWG+EW+ K+E +LGPFS WNI+GTY Sbjct: 23 VGILLRISCGWLVFMLFFSPVAGLRPLRDRTNSWGDEWVFTRKDESDLGPFSQWNISGTY 82 Query: 320 RGNW 331 RGNW Sbjct: 83 RGNW 86