BLASTX nr result
ID: Scutellaria24_contig00018474
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00018474 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273082.1| PREDICTED: sorting and assembly machinery co... 65 4e-09 emb|CAN84130.1| hypothetical protein VITISV_041873 [Vitis vinifera] 65 4e-09 ref|XP_004140074.1| PREDICTED: sorting and assembly machinery co... 64 2e-08 ref|XP_002528327.1| sorting and assembly machinery (sam50) prote... 63 3e-08 ref|XP_003600958.1| Sorting and assembly machinery component-lik... 60 1e-07 >ref|XP_002273082.1| PREDICTED: sorting and assembly machinery component 50 homolog B-like [Vitis vinifera] Length = 534 Score = 65.5 bits (158), Expect = 4e-09 Identities = 28/50 (56%), Positives = 43/50 (86%) Frame = -3 Query: 166 EARMRMERASMESLFNRLSTERVPVHVHDIIIKGNTKTKDSLIESEVEAV 17 E+R+ + + +ES+F RL++E+V + VHD++IKGNTKTKDSLIE+E+EA+ Sbjct: 58 ESRLAEDGSKLESMFRRLASEKVKLRVHDVLIKGNTKTKDSLIEAELEAI 107 >emb|CAN84130.1| hypothetical protein VITISV_041873 [Vitis vinifera] Length = 564 Score = 65.5 bits (158), Expect = 4e-09 Identities = 28/50 (56%), Positives = 43/50 (86%) Frame = -3 Query: 166 EARMRMERASMESLFNRLSTERVPVHVHDIIIKGNTKTKDSLIESEVEAV 17 E+R+ + + +ES+F RL++E+V + VHD++IKGNTKTKDSLIE+E+EA+ Sbjct: 58 ESRLAEDGSKLESMFRRLASEKVKLRVHDVLIKGNTKTKDSLIEAELEAI 107 >ref|XP_004140074.1| PREDICTED: sorting and assembly machinery component 50 homolog [Cucumis sativus] gi|449490420|ref|XP_004158600.1| PREDICTED: sorting and assembly machinery component 50 homolog [Cucumis sativus] Length = 536 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/53 (54%), Positives = 42/53 (79%) Frame = -3 Query: 175 MTPEARMRMERASMESLFNRLSTERVPVHVHDIIIKGNTKTKDSLIESEVEAV 17 +T +R+ +R+ +E+L R+ E+V + VHDI+IKGNTKTKDSLIE+EVEA+ Sbjct: 56 VTDASRLLAQRSKLENLVERMRKEKVRLRVHDILIKGNTKTKDSLIEAEVEAI 108 >ref|XP_002528327.1| sorting and assembly machinery (sam50) protein, putative [Ricinus communis] gi|223532282|gb|EEF34085.1| sorting and assembly machinery (sam50) protein, putative [Ricinus communis] Length = 518 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/55 (52%), Positives = 43/55 (78%) Frame = -3 Query: 166 EARMRMERASMESLFNRLSTERVPVHVHDIIIKGNTKTKDSLIESEVEAVLREAA 2 E++ R+ER +E+L R+ TE VP+ VHD+IIKGN KTKDS++ESE A+L++ + Sbjct: 42 ESQARVEREKVENLIRRMQTETVPLRVHDVIIKGNVKTKDSILESET-ALLKDVS 95 >ref|XP_003600958.1| Sorting and assembly machinery component-like protein [Medicago truncatula] gi|355490006|gb|AES71209.1| Sorting and assembly machinery component-like protein [Medicago truncatula] Length = 516 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/52 (50%), Positives = 42/52 (80%) Frame = -3 Query: 172 TPEARMRMERASMESLFNRLSTERVPVHVHDIIIKGNTKTKDSLIESEVEAV 17 +P +R+R ++ +E+L RLS+E VP+ VHD+II+GNTKTKD +IE+E++ + Sbjct: 37 SPLSRLRDQKFKLETLSRRLSSELVPIRVHDVIIRGNTKTKDWVIEAELKGI 88