BLASTX nr result
ID: Scutellaria24_contig00018442
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00018442 (431 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003545546.1| PREDICTED: uncharacterized protein LOC100813... 120 9e-26 ref|XP_002532121.1| conserved hypothetical protein [Ricinus comm... 120 1e-25 ref|XP_003549199.1| PREDICTED: uncharacterized protein LOC100800... 117 1e-24 ref|XP_002324952.1| predicted protein [Populus trichocarpa] gi|2... 115 3e-24 ref|XP_002272001.1| PREDICTED: uncharacterized protein LOC100263... 115 5e-24 >ref|XP_003545546.1| PREDICTED: uncharacterized protein LOC100813676 [Glycine max] Length = 68 Score = 120 bits (302), Expect = 9e-26 Identities = 51/62 (82%), Positives = 57/62 (91%) Frame = +2 Query: 182 MCLVLVCDEEERVIGRQVAPGACPYCGGMVQAMDVQSNWRFCFVPLYFKTKRKLYCTICS 361 MCLV VCDEEERV+GRQ APGACPYCGGMVQA+DV+S WRFCF+PL FKTKRK YCT+C+ Sbjct: 1 MCLVFVCDEEERVLGRQTAPGACPYCGGMVQAIDVESQWRFCFLPLCFKTKRKYYCTMCT 60 Query: 362 RR 367 RR Sbjct: 61 RR 62 >ref|XP_002532121.1| conserved hypothetical protein [Ricinus communis] gi|223528201|gb|EEF30261.1| conserved hypothetical protein [Ricinus communis] Length = 67 Score = 120 bits (301), Expect = 1e-25 Identities = 49/62 (79%), Positives = 57/62 (91%) Frame = +2 Query: 182 MCLVLVCDEEERVIGRQVAPGACPYCGGMVQAMDVQSNWRFCFVPLYFKTKRKLYCTICS 361 MCLV VCDEEERV+ RQ APGACPYCGGMVQAMDV+S WRFCF+PLYFKTK++ YC++C+ Sbjct: 1 MCLVFVCDEEERVVARQPAPGACPYCGGMVQAMDVESQWRFCFLPLYFKTKKRFYCSVCA 60 Query: 362 RR 367 RR Sbjct: 61 RR 62 >ref|XP_003549199.1| PREDICTED: uncharacterized protein LOC100800541 [Glycine max] Length = 66 Score = 117 bits (292), Expect = 1e-24 Identities = 49/62 (79%), Positives = 57/62 (91%) Frame = +2 Query: 182 MCLVLVCDEEERVIGRQVAPGACPYCGGMVQAMDVQSNWRFCFVPLYFKTKRKLYCTICS 361 MCLV VC+EEERV+GRQ APGACPYCGGMVQA++V+S WRFCF+PL FKTKRK YCT+C+ Sbjct: 1 MCLVFVCNEEERVLGRQTAPGACPYCGGMVQAINVESQWRFCFLPLCFKTKRKYYCTMCT 60 Query: 362 RR 367 RR Sbjct: 61 RR 62 >ref|XP_002324952.1| predicted protein [Populus trichocarpa] gi|222866386|gb|EEF03517.1| predicted protein [Populus trichocarpa] Length = 67 Score = 115 bits (289), Expect = 3e-24 Identities = 45/62 (72%), Positives = 56/62 (90%) Frame = +2 Query: 182 MCLVLVCDEEERVIGRQVAPGACPYCGGMVQAMDVQSNWRFCFVPLYFKTKRKLYCTICS 361 MCLV VCDE+E+V+ RQ APGACPYCGG +QAMDV+S WRFCF+PLYFKTK++ YCT+C+ Sbjct: 1 MCLVFVCDEDEKVVARQTAPGACPYCGGAIQAMDVESQWRFCFLPLYFKTKKRYYCTLCA 60 Query: 362 RR 367 R+ Sbjct: 61 RK 62 >ref|XP_002272001.1| PREDICTED: uncharacterized protein LOC100263050 [Vitis vinifera] Length = 67 Score = 115 bits (287), Expect = 5e-24 Identities = 45/62 (72%), Positives = 56/62 (90%) Frame = +2 Query: 182 MCLVLVCDEEERVIGRQVAPGACPYCGGMVQAMDVQSNWRFCFVPLYFKTKRKLYCTICS 361 MCLV VCD+EERV+GR APGACPYCGGM+QAMDV+S WRFCF+P +F+TKRK +C++C+ Sbjct: 1 MCLVFVCDQEERVVGRHPAPGACPYCGGMIQAMDVESAWRFCFLPFFFRTKRKFFCSVCT 60 Query: 362 RR 367 RR Sbjct: 61 RR 62