BLASTX nr result
ID: Scutellaria24_contig00018269
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00018269 (364 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521580.1| conserved hypothetical protein [Ricinus comm... 74 1e-11 ref|XP_002327814.1| predicted protein [Populus trichocarpa] gi|2... 74 2e-11 ref|XP_002310220.1| predicted protein [Populus trichocarpa] gi|2... 71 1e-10 ref|XP_002310219.1| predicted protein [Populus trichocarpa] gi|2... 70 2e-10 ref|XP_002521581.1| conserved hypothetical protein [Ricinus comm... 65 4e-09 >ref|XP_002521580.1| conserved hypothetical protein [Ricinus communis] gi|223539258|gb|EEF40851.1| conserved hypothetical protein [Ricinus communis] Length = 339 Score = 73.9 bits (180), Expect = 1e-11 Identities = 34/74 (45%), Positives = 52/74 (70%), Gaps = 1/74 (1%) Frame = +2 Query: 146 KLSRDMDLKGIVKDIVLPFLPAKALAKFKSVSKEWDRWIKNPFLVHQQSYYFKGLSGFFC 325 K+ R + + IVK+ LPFL AK+L KF++VSK+WD+WI +PF H+Q+ ++K +SG F Sbjct: 78 KMQRGVGIGDIVKEHALPFLSAKSLCKFRTVSKQWDQWIISPFFAHKQTVHYKNVSGLFR 137 Query: 326 QHYGH-HTFVSLDE 364 Q G +F+S D+ Sbjct: 138 QLPGRCPSFISFDQ 151 >ref|XP_002327814.1| predicted protein [Populus trichocarpa] gi|222836899|gb|EEE75292.1| predicted protein [Populus trichocarpa] Length = 342 Score = 73.6 bits (179), Expect = 2e-11 Identities = 34/68 (50%), Positives = 49/68 (72%), Gaps = 1/68 (1%) Frame = +2 Query: 161 MDLKGIVKDIVLPFLPAKALAKFKSVSKEWDRWIKNPFLVHQQSYYFKGLSGFFCQHYGH 340 M+++ +V+ L FLPAK+L +FK+VSKEW RWI PF VH Q+ +F+ +SG FCQ G Sbjct: 1 MEIQDVVRQYALCFLPAKSLCRFKTVSKEWLRWINCPFFVHTQTNHFRHISGLFCQFPGE 60 Query: 341 H-TFVSLD 361 +F+SL+ Sbjct: 61 SPSFMSLN 68 >ref|XP_002310220.1| predicted protein [Populus trichocarpa] gi|222853123|gb|EEE90670.1| predicted protein [Populus trichocarpa] Length = 405 Score = 70.9 bits (172), Expect = 1e-10 Identities = 31/69 (44%), Positives = 49/69 (71%), Gaps = 1/69 (1%) Frame = +2 Query: 158 DMDLKGIVKDIVLPFLPAKALAKFKSVSKEWDRWIKNPFLVHQQSYYFKGLSGFFCQHYG 337 D+ ++ +V+ L FLPAK++ +FK+VSKEW +WI +PF H+Q+ +FK +SG FCQ G Sbjct: 57 DIKIEDVVRQYALCFLPAKSICRFKTVSKEWLKWIDSPFFSHKQTNHFKHVSGLFCQFPG 116 Query: 338 HH-TFVSLD 361 +F+S + Sbjct: 117 ESPSFISFN 125 >ref|XP_002310219.1| predicted protein [Populus trichocarpa] gi|222853122|gb|EEE90669.1| predicted protein [Populus trichocarpa] Length = 360 Score = 69.7 bits (169), Expect = 2e-10 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 1/68 (1%) Frame = +2 Query: 161 MDLKGIVKDIVLPFLPAKALAKFKSVSKEWDRWIKNPFLVHQQSYYFKGLSGFFCQH-YG 337 MDL+ I+++ LPFLPAK+L + V +EW I PF H QSY F+ +SGFFCQ G Sbjct: 20 MDLQDIIRESALPFLPAKSLHRCTGVCREWKLQISTPFFAHNQSYSFRDVSGFFCQSPSG 79 Query: 338 HHTFVSLD 361 +FVSL+ Sbjct: 80 TPSFVSLN 87 >ref|XP_002521581.1| conserved hypothetical protein [Ricinus communis] gi|223539259|gb|EEF40852.1| conserved hypothetical protein [Ricinus communis] Length = 356 Score = 65.5 bits (158), Expect = 4e-09 Identities = 33/68 (48%), Positives = 44/68 (64%), Gaps = 1/68 (1%) Frame = +2 Query: 161 MDLKGIVKDIVLPFLPAKALAKFKSVSKEWDRWIKNPFLVHQQSYYFKGLSGFFCQHYGH 340 MDLK IV++ L +LPAK+L +F SV ++W +I PFL H QS F +SG FCQ Sbjct: 20 MDLKDIVREHALRYLPAKSLCRFTSVCRDWRLYISTPFLAHNQSNSFGDVSGLFCQSDSS 79 Query: 341 -HTFVSLD 361 +F+SLD Sbjct: 80 LPSFISLD 87