BLASTX nr result
ID: Scutellaria24_contig00017664
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00017664 (465 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267185.2| PREDICTED: DUF246 domain-containing protein ... 75 5e-12 emb|CAN66567.1| hypothetical protein VITISV_039538 [Vitis vinifera] 75 5e-12 ref|XP_002530648.1| conserved hypothetical protein [Ricinus comm... 72 5e-11 ref|XP_002326456.1| predicted protein [Populus trichocarpa] gi|2... 72 5e-11 ref|XP_004147217.1| PREDICTED: DUF246 domain-containing protein ... 70 2e-10 >ref|XP_002267185.2| PREDICTED: DUF246 domain-containing protein At1g04910-like [Vitis vinifera] gi|297744383|emb|CBI37357.3| unnamed protein product [Vitis vinifera] Length = 572 Score = 75.1 bits (183), Expect = 5e-12 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = -3 Query: 181 PVPWTVVCGLLLFAVGLISLFTGHVASDLEWYSQRFVNRTWYYK 50 P+ W+++CGL+LF +GLISLFTGHVASDLEWYSQR V R+ Y K Sbjct: 45 PISWSIICGLMLFCLGLISLFTGHVASDLEWYSQRLVKRSLYSK 88 >emb|CAN66567.1| hypothetical protein VITISV_039538 [Vitis vinifera] Length = 557 Score = 75.1 bits (183), Expect = 5e-12 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = -3 Query: 181 PVPWTVVCGLLLFAVGLISLFTGHVASDLEWYSQRFVNRTWYYK 50 P+ W+++CGL+LF +GLISLFTGHVASDLEWYSQR V R+ Y K Sbjct: 45 PISWSIICGLMLFCLGLISLFTGHVASDLEWYSQRLVKRSLYSK 88 >ref|XP_002530648.1| conserved hypothetical protein [Ricinus communis] gi|223529781|gb|EEF31717.1| conserved hypothetical protein [Ricinus communis] Length = 592 Score = 72.0 bits (175), Expect = 5e-11 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = -3 Query: 178 VPWTVVCGLLLFAVGLISLFTGHVASDLEWYSQRFVNRT 62 +PW++VCGL+LF +GLISLFTGHVASDLEWYSQR V R+ Sbjct: 62 IPWSLVCGLMLFVLGLISLFTGHVASDLEWYSQRLVKRS 100 >ref|XP_002326456.1| predicted protein [Populus trichocarpa] gi|222833778|gb|EEE72255.1| predicted protein [Populus trichocarpa] Length = 522 Score = 72.0 bits (175), Expect = 5e-11 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = -3 Query: 178 VPWTVVCGLLLFAVGLISLFTGHVASDLEWYSQRFVNRTWYYKRV 44 VP ++VCG +LF +GLISLFTGHVASDLEWYSQR V R+++Y R+ Sbjct: 12 VPRSLVCGFMLFGLGLISLFTGHVASDLEWYSQRLVKRSFFYSRL 56 >ref|XP_004147217.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis sativus] gi|449504948|ref|XP_004162338.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis sativus] Length = 551 Score = 69.7 bits (169), Expect = 2e-10 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = -3 Query: 172 WTVVCGLLLFAVGLISLFTGHVASDLEWYSQRFVNRTWYYK 50 W+++CG++LFA+GLISLFTGH+ASDLEWYSQ VNR Y K Sbjct: 50 WSMLCGVMLFALGLISLFTGHIASDLEWYSQHLVNRRLYSK 90