BLASTX nr result
ID: Scutellaria24_contig00017513
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00017513 (707 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004170431.1| PREDICTED: exosome complex component RRP45-l... 47 8e-06 ref|XP_004139042.1| PREDICTED: exosome complex component RRP45-l... 47 8e-06 >ref|XP_004170431.1| PREDICTED: exosome complex component RRP45-like [Cucumis sativus] Length = 454 Score = 46.6 bits (109), Expect(2) = 8e-06 Identities = 19/33 (57%), Positives = 28/33 (84%) Frame = +2 Query: 131 MMERVANSWRMAVNDKKFIESALLSDIRIVDEG 229 M +R+AN+WR++ N+KKFIE+ALLSD+R+ G Sbjct: 1 MEQRLANTWRLSANEKKFIETALLSDLRVDGRG 33 Score = 28.9 bits (63), Expect(2) = 8e-06 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 220 GRGPFDYRNLT 252 GRGPFDYRNLT Sbjct: 31 GRGPFDYRNLT 41 >ref|XP_004139042.1| PREDICTED: exosome complex component RRP45-like [Cucumis sativus] Length = 452 Score = 46.6 bits (109), Expect(2) = 8e-06 Identities = 19/33 (57%), Positives = 28/33 (84%) Frame = +2 Query: 131 MMERVANSWRMAVNDKKFIESALLSDIRIVDEG 229 M +R+AN+WR++ N+KKFIE+ALLSD+R+ G Sbjct: 1 MEQRLANTWRLSANEKKFIETALLSDLRVDGRG 33 Score = 28.9 bits (63), Expect(2) = 8e-06 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 220 GRGPFDYRNLT 252 GRGPFDYRNLT Sbjct: 31 GRGPFDYRNLT 41