BLASTX nr result
ID: Scutellaria24_contig00017153
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00017153 (574 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519626.1| conserved hypothetical protein [Ricinus comm... 72 6e-11 ref|XP_002869608.1| hypothetical protein ARALYDRAFT_913911 [Arab... 70 2e-10 ref|XP_002264234.1| PREDICTED: uncharacterized protein LOC100249... 70 2e-10 emb|CAN70940.1| hypothetical protein VITISV_001966 [Vitis vinifera] 70 2e-10 ref|XP_002330544.1| predicted protein [Populus trichocarpa] gi|2... 69 7e-10 >ref|XP_002519626.1| conserved hypothetical protein [Ricinus communis] gi|223541216|gb|EEF42771.1| conserved hypothetical protein [Ricinus communis] Length = 254 Score = 72.0 bits (175), Expect = 6e-11 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = +3 Query: 3 GTFKVRVKFGAIHYSYWLHGDCQLEMTSPPNSILITHSCKTKR 131 GTF+VR G IHYSYWLHG C++EMT PP +L+ SCKTKR Sbjct: 212 GTFRVRASLGLIHYSYWLHGRCEIEMTGPPTGVLVARSCKTKR 254 >ref|XP_002869608.1| hypothetical protein ARALYDRAFT_913911 [Arabidopsis lyrata subsp. lyrata] gi|297315444|gb|EFH45867.1| hypothetical protein ARALYDRAFT_913911 [Arabidopsis lyrata subsp. lyrata] Length = 269 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +3 Query: 3 GTFKVRVKFGAIHYSYWLHGDCQLEMTSPPNSILITHSCKTKR 131 GTFKVR FG IHYSY LHG CQL+MT PP ILI+H+C TK+ Sbjct: 226 GTFKVRAHFGMIHYSYSLHGRCQLQMTGPPTGILISHNCTTKK 268 >ref|XP_002264234.1| PREDICTED: uncharacterized protein LOC100249744 [Vitis vinifera] Length = 217 Score = 70.1 bits (170), Expect = 2e-10 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = +3 Query: 3 GTFKVRVKFGAIHYSYWLHGDCQLEMTSPPNSILITHSCKTKR 131 GTF+VR G H+SYWLHG CQL+MT PP +L+T SC+TKR Sbjct: 175 GTFRVRANLGLTHFSYWLHGRCQLDMTGPPTGVLVTRSCRTKR 217 >emb|CAN70940.1| hypothetical protein VITISV_001966 [Vitis vinifera] Length = 231 Score = 70.1 bits (170), Expect = 2e-10 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = +3 Query: 3 GTFKVRVKFGAIHYSYWLHGDCQLEMTSPPNSILITHSCKTKR 131 GTF+VR G H+SYWLHG CQL+MT PP +L+T SC+TKR Sbjct: 189 GTFRVRANLGLTHFSYWLHGRCQLDMTGPPTGVLVTRSCRTKR 231 >ref|XP_002330544.1| predicted protein [Populus trichocarpa] gi|222872102|gb|EEF09233.1| predicted protein [Populus trichocarpa] Length = 197 Score = 68.6 bits (166), Expect = 7e-10 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = +3 Query: 3 GTFKVRVKFGAIHYSYWLHGDCQLEMTSPPNSILITHSCKTK 128 GTFKVR G +HYSYWLHG C++EMT PP +++ SC+TK Sbjct: 156 GTFKVRANMGLLHYSYWLHGRCEIEMTGPPTGVIVARSCRTK 197