BLASTX nr result
ID: Scutellaria24_contig00017082
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00017082 (256 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509864.1| WRKY transcription factor, putative [Ricinus... 69 3e-10 ref|XP_002511926.1| WRKY transcription factor, putative [Ricinus... 67 1e-09 gb|ACV92021.1| WRKY transcription factor 19 [(Populus tomentosa ... 64 1e-08 ref|XP_003567084.1| PREDICTED: probable WRKY transcription facto... 64 2e-08 ref|XP_003549123.1| PREDICTED: probable WRKY transcription facto... 63 2e-08 >ref|XP_002509864.1| WRKY transcription factor, putative [Ricinus communis] gi|223549763|gb|EEF51251.1| WRKY transcription factor, putative [Ricinus communis] Length = 185 Score = 69.3 bits (168), Expect = 3e-10 Identities = 36/80 (45%), Positives = 47/80 (58%), Gaps = 4/80 (5%) Frame = +3 Query: 27 SSDQIDLAGLMSS----GSMEQKPVSSRNIGEVHDQINGSRNKSRFGKKKKYVPPRVAFH 194 +SD ID L+S G P ++R D N NK + G+ KK P R++FH Sbjct: 45 ASDHIDWVSLLSGSFQFGDQNLTPPTAR------DSENAVTNKKKGGRAKKTTPQRISFH 98 Query: 195 TRSEEDILDDGYKWRKYGQK 254 TRS +DILDDG++WRKYGQK Sbjct: 99 TRSADDILDDGFRWRKYGQK 118 >ref|XP_002511926.1| WRKY transcription factor, putative [Ricinus communis] gi|223549106|gb|EEF50595.1| WRKY transcription factor, putative [Ricinus communis] Length = 192 Score = 67.4 bits (163), Expect = 1e-09 Identities = 39/79 (49%), Positives = 53/79 (67%), Gaps = 7/79 (8%) Frame = +3 Query: 39 IDLAGLMSSGSM--EQKPVSSRN---IGEVH-DQINGSRNKSR-FGKKKKYVPPRVAFHT 197 ID L+SS S+ E +P+ N IGE ++ G+++K R G+ KK++ PR AF T Sbjct: 51 IDWVALLSSQSVVGENRPMMMENASLIGETGAEEEKGNKDKLRKSGRIKKHITPRFAFQT 110 Query: 198 RSEEDILDDGYKWRKYGQK 254 RS +DILDDGY+WRKYGQK Sbjct: 111 RSADDILDDGYRWRKYGQK 129 >gb|ACV92021.1| WRKY transcription factor 19 [(Populus tomentosa x P. bolleana) x P. tomentosa] Length = 192 Score = 63.9 bits (154), Expect = 1e-08 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 5/77 (6%) Frame = +3 Query: 39 IDLAGLMSSGSM--EQKPV--SSRNIGEVH-DQINGSRNKSRFGKKKKYVPPRVAFHTRS 203 ID GL+S S E++PV S+ + E ++ G++++ + G+ K+ PR AF TRS Sbjct: 49 IDWVGLLSGQSQLGEKRPVTESASMVAENGAEEEKGNKDEKKGGRMKRATRPRFAFQTRS 108 Query: 204 EEDILDDGYKWRKYGQK 254 +DILDDGY+WRKYGQK Sbjct: 109 ADDILDDGYRWRKYGQK 125 >ref|XP_003567084.1| PREDICTED: probable WRKY transcription factor 12-like [Brachypodium distachyon] Length = 222 Score = 63.5 bits (153), Expect = 2e-08 Identities = 36/80 (45%), Positives = 44/80 (55%) Frame = +3 Query: 15 PAAASSDQIDLAGLMSSGSMEQKPVSSRNIGEVHDQINGSRNKSRFGKKKKYVPPRVAFH 194 PAA S Q + +G + + S G ++ G +S KKKK PR AF Sbjct: 79 PAAPSERQEEAVQADQNGENDGEASSG---GSGKEKAMGGAGRSGKKKKKKVSKPRFAFQ 135 Query: 195 TRSEEDILDDGYKWRKYGQK 254 TRSE DILDDGY+WRKYGQK Sbjct: 136 TRSENDILDDGYRWRKYGQK 155 >ref|XP_003549123.1| PREDICTED: probable WRKY transcription factor 56-like [Glycine max] Length = 195 Score = 63.2 bits (152), Expect = 2e-08 Identities = 32/64 (50%), Positives = 41/64 (64%), Gaps = 1/64 (1%) Frame = +3 Query: 66 GSMEQKPVSSRNIGEVHDQINGSRNKSRFGK-KKKYVPPRVAFHTRSEEDILDDGYKWRK 242 G+M +S + V D++ GS N + K +KK PR AF TRS+ DILDDGY+WRK Sbjct: 65 GNMLMSQISGGSNTNVSDELGGSGNSNNKKKGEKKVKKPRYAFQTRSQVDILDDGYRWRK 124 Query: 243 YGQK 254 YGQK Sbjct: 125 YGQK 128