BLASTX nr result
ID: Scutellaria24_contig00016464
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00016464 (239 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD32888.1|AC005489_26 F14N23.26 [Arabidopsis thaliana] 62 4e-08 emb|CAC94004.1| glutathione transferase [Triticum aestivum] 62 4e-08 ref|XP_003574241.1| PREDICTED: probable glutathione S-transferas... 62 4e-08 sp|Q03663.1|GSTX2_TOBAC RecName: Full=Probable glutathione S-tra... 62 4e-08 gb|AAX20044.1| probable glutathione-S-transferase [Capsicum annuum] 62 5e-08 >gb|AAD32888.1|AC005489_26 F14N23.26 [Arabidopsis thaliana] Length = 121 Score = 62.4 bits (150), Expect = 4e-08 Identities = 29/46 (63%), Positives = 33/46 (71%), Gaps = 2/46 (4%) Frame = +1 Query: 1 IVEYIDEVWG--GPSILPKDPYERANARFWVKYIDEKVITYIF*SC 132 IVEYID+ W GPSILP DPY+RA ARFW YIDEKV + +C Sbjct: 71 IVEYIDDTWSSSGPSILPSDPYDRAMARFWAAYIDEKVFFFSSFTC 116 >emb|CAC94004.1| glutathione transferase [Triticum aestivum] Length = 233 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/38 (71%), Positives = 31/38 (81%), Gaps = 2/38 (5%) Frame = +1 Query: 1 IVEYIDEVWGG--PSILPKDPYERANARFWVKYIDEKV 108 IV+YIDEVW G PS+LP DPYERA ARFW Y+D+KV Sbjct: 72 IVQYIDEVWAGAGPSVLPADPYERATARFWAAYVDDKV 109 >ref|XP_003574241.1| PREDICTED: probable glutathione S-transferase GSTU6-like [Brachypodium distachyon] Length = 235 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/39 (71%), Positives = 31/39 (79%), Gaps = 3/39 (7%) Frame = +1 Query: 1 IVEYIDEVWGG---PSILPKDPYERANARFWVKYIDEKV 108 IV+YIDEVW G PSILP DPYERA ARFW Y+D+KV Sbjct: 73 IVQYIDEVWSGTGVPSILPADPYERATARFWAAYVDDKV 111 >sp|Q03663.1|GSTX2_TOBAC RecName: Full=Probable glutathione S-transferase; AltName: Full=Auxin-induced protein PGNT35/PCNT111 gi|19797|emb|CAA39706.1| auxin-induced protein [Nicotiana tabacum] gi|19801|emb|CAA39710.1| auxin-induced protein [Nicotiana tabacum] Length = 223 Score = 62.4 bits (150), Expect = 4e-08 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +1 Query: 1 IVEYIDEVWGGPSILPKDPYERANARFWVKYIDEKVITYI 120 I+EYIDE + GPSILPKDPY+RA ARFW K++D+KV + Sbjct: 69 ILEYIDETFEGPSILPKDPYDRALARFWAKFLDDKVAAVV 108 >gb|AAX20044.1| probable glutathione-S-transferase [Capsicum annuum] Length = 220 Score = 62.0 bits (149), Expect = 5e-08 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +1 Query: 1 IVEYIDEVWGGPSILPKDPYERANARFWVKYIDEKV 108 IVEYIDE + GPSILPKDPY+RA ARFW K++D+K+ Sbjct: 69 IVEYIDEAFEGPSILPKDPYDRAIARFWAKFLDDKL 104