BLASTX nr result
ID: Scutellaria24_contig00016099
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00016099 (330 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC01624.1| putative pectin methylesterase [Populus tremula ... 55 8e-06 >emb|CAC01624.1| putative pectin methylesterase [Populus tremula x Populus tremuloides] Length = 579 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 2/57 (3%) Frame = -2 Query: 167 KTLILTAFASLLVVALVSITI--VQSHKSHGGAAAQAVVKSTCAATLYPELCVSTIS 3 K L+L +FA+L +VA ++ + V SHK+ A AV+KS C++TLYPELC S I+ Sbjct: 25 KRLLLASFAALFLVATIAAVVAGVNSHKNGENEGAHAVLKSACSSTLYPELCYSAIA 81