BLASTX nr result
ID: Scutellaria24_contig00016090
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00016090 (407 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGF30364.1| CYP450 monooxygenase CYP82D33 [Ocimum basilicum] 91 7e-17 gb|AGF30366.1| CYP450 monooxygenase CYP82D62 [Mentha x piperita] 90 2e-16 ref|XP_003517268.1| PREDICTED: cytochrome P450 82A3-like [Glycin... 82 3e-14 ref|XP_003618345.1| Cytochrome P450 [Medicago truncatula] gi|355... 80 2e-13 ref|XP_003537400.1| PREDICTED: cytochrome P450 82A3-like [Glycin... 79 5e-13 >gb|AGF30364.1| CYP450 monooxygenase CYP82D33 [Ocimum basilicum] Length = 534 Score = 91.3 bits (225), Expect = 7e-17 Identities = 41/63 (65%), Positives = 53/63 (84%) Frame = +1 Query: 1 PFGAGRRMCPGSNLGMHMVHLILANILQAFDLRAGSDECLDMTESAGSTNIKATSLDVLF 180 PFGAGRR+CPG + G+ M+HL+LA++LQAFD+ SDE +DM+ESAG TN+KAT LDV+ Sbjct: 459 PFGAGRRICPGLSFGLQMLHLVLASLLQAFDMSTVSDEAVDMSESAGLTNMKATPLDVVV 518 Query: 181 TPR 189 TPR Sbjct: 519 TPR 521 >gb|AGF30366.1| CYP450 monooxygenase CYP82D62 [Mentha x piperita] Length = 516 Score = 90.1 bits (222), Expect = 2e-16 Identities = 42/63 (66%), Positives = 52/63 (82%) Frame = +1 Query: 1 PFGAGRRMCPGSNLGMHMVHLILANILQAFDLRAGSDECLDMTESAGSTNIKATSLDVLF 180 PF AGRR+CPG+N G+ M+HL+LA++LQAFDL S+E +DM+ESAG TNIKAT LDVL Sbjct: 447 PFSAGRRICPGTNFGLQMLHLVLASLLQAFDLSRVSNEEIDMSESAGLTNIKATPLDVLI 506 Query: 181 TPR 189 PR Sbjct: 507 APR 509 >ref|XP_003517268.1| PREDICTED: cytochrome P450 82A3-like [Glycine max] Length = 530 Score = 82.4 bits (202), Expect = 3e-14 Identities = 35/63 (55%), Positives = 52/63 (82%) Frame = +1 Query: 1 PFGAGRRMCPGSNLGMHMVHLILANILQAFDLRAGSDECLDMTESAGSTNIKATSLDVLF 180 PFG+GRR+CPGS+L + +VH++LA +L +F++ + S++ +DMTES G TN+KAT L+VL Sbjct: 460 PFGSGRRVCPGSSLALRVVHMVLARLLHSFNVASPSNQAVDMTESIGLTNLKATPLEVLL 519 Query: 181 TPR 189 TPR Sbjct: 520 TPR 522 >ref|XP_003618345.1| Cytochrome P450 [Medicago truncatula] gi|355493360|gb|AES74563.1| Cytochrome P450 [Medicago truncatula] Length = 524 Score = 79.7 bits (195), Expect = 2e-13 Identities = 35/62 (56%), Positives = 47/62 (75%) Frame = +1 Query: 1 PFGAGRRMCPGSNLGMHMVHLILANILQAFDLRAGSDECLDMTESAGSTNIKATSLDVLF 180 PFG+GRR+CPG + G+HM+HL LAN L +F++ GS E +DMTE+ G TN KAT L++L Sbjct: 453 PFGSGRRICPGISFGLHMIHLTLANFLHSFEIVNGSSEPVDMTENLGMTNEKATPLEILV 512 Query: 181 TP 186 P Sbjct: 513 KP 514 >ref|XP_003537400.1| PREDICTED: cytochrome P450 82A3-like [Glycine max] Length = 538 Score = 78.6 bits (192), Expect = 5e-13 Identities = 35/63 (55%), Positives = 49/63 (77%) Frame = +1 Query: 1 PFGAGRRMCPGSNLGMHMVHLILANILQAFDLRAGSDECLDMTESAGSTNIKATSLDVLF 180 PF +GRR CPG++L + +VHL LA +L +FD+ + S++ +DMTES G TN+KAT L+VL Sbjct: 463 PFSSGRRACPGASLALRVVHLTLARLLHSFDVASPSNQVVDMTESFGLTNLKATPLEVLL 522 Query: 181 TPR 189 TPR Sbjct: 523 TPR 525