BLASTX nr result
ID: Scutellaria24_contig00016084
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00016084 (314 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276825.1| PREDICTED: UDP-glycosyltransferase 83A1 [Vit... 62 5e-08 ref|XP_002526109.1| UDP-glucuronosyltransferase, putative [Ricin... 61 8e-08 emb|CBI33785.3| unnamed protein product [Vitis vinifera] 60 1e-07 ref|XP_002272457.1| PREDICTED: UDP-glycosyltransferase 83A1 [Vit... 60 1e-07 ref|XP_002324098.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 >ref|XP_002276825.1| PREDICTED: UDP-glycosyltransferase 83A1 [Vitis vinifera] Length = 453 Score = 62.0 bits (149), Expect = 5e-08 Identities = 30/57 (52%), Positives = 41/57 (71%), Gaps = 2/57 (3%) Frame = -3 Query: 300 DESGIIRQEEIRKKVELLLTDENYKTRALNLQSKAVSSAR--GRSENNFSNFVNWIK 136 DE+GII ++EI+ KV LL DE +++RALNL+ A+ S + G S NNF NFV W+K Sbjct: 396 DENGIITRKEIKNKVGQLLGDEKFRSRALNLKEMAIDSVKEGGPSHNNFKNFVEWLK 452 >ref|XP_002526109.1| UDP-glucuronosyltransferase, putative [Ricinus communis] gi|223534606|gb|EEF36303.1| UDP-glucuronosyltransferase, putative [Ricinus communis] Length = 409 Score = 61.2 bits (147), Expect = 8e-08 Identities = 30/59 (50%), Positives = 43/59 (72%), Gaps = 2/59 (3%) Frame = -3 Query: 306 DKDESGIIRQEEIRKKVELLLTDENYKTRALNLQSKAVSSA--RGRSENNFSNFVNWIK 136 D++ESGII +EEI+ K+E +++DEN+K RAL L+ A+ S G S N F NF++WIK Sbjct: 350 DRNESGIITREEIKNKMEQVVSDENFKARALQLKEIALESVGESGHSNNVFRNFLDWIK 408 >emb|CBI33785.3| unnamed protein product [Vitis vinifera] Length = 427 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/57 (52%), Positives = 39/57 (68%), Gaps = 2/57 (3%) Frame = -3 Query: 300 DESGIIRQEEIRKKVELLLTDENYKTRALNLQSKAVSSAR--GRSENNFSNFVNWIK 136 DE GII +EEI+ KVE LL DEN++ RA NL+ A++ R G S NNF F+ W+K Sbjct: 370 DERGIITREEIKHKVEQLLGDENFRIRASNLKESAMNCVREGGSSYNNFQRFIQWLK 426 >ref|XP_002272457.1| PREDICTED: UDP-glycosyltransferase 83A1 [Vitis vinifera] Length = 453 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/57 (52%), Positives = 39/57 (68%), Gaps = 2/57 (3%) Frame = -3 Query: 300 DESGIIRQEEIRKKVELLLTDENYKTRALNLQSKAVSSAR--GRSENNFSNFVNWIK 136 DE GII +EEI+ KVE LL DEN++ RA NL+ A++ R G S NNF F+ W+K Sbjct: 396 DERGIITREEIKHKVEQLLGDENFRIRASNLKESAMNCVREGGSSYNNFQRFIQWLK 452 >ref|XP_002324098.1| predicted protein [Populus trichocarpa] gi|222867100|gb|EEF04231.1| predicted protein [Populus trichocarpa] Length = 454 Score = 59.7 bits (143), Expect = 2e-07 Identities = 30/60 (50%), Positives = 41/60 (68%), Gaps = 2/60 (3%) Frame = -3 Query: 309 LDKDESGIIRQEEIRKKVELLLTDENYKTRALNLQSKAVSSA--RGRSENNFSNFVNWIK 136 LDK++SGI+ EEI+ KVE ++ DE +K RAL L+ A+ + G S NNF NFV W+K Sbjct: 394 LDKNQSGIVTGEEIKNKVEKVVGDEKFKARALELKRLAMQNVGEGGCSSNNFKNFVEWMK 453