BLASTX nr result
ID: Scutellaria24_contig00015951
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00015951 (274 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306655.1| predicted protein [Populus trichocarpa] gi|2... 74 1e-11 ref|XP_002302218.1| predicted protein [Populus trichocarpa] gi|2... 74 1e-11 ref|XP_002520305.1| ATP binding protein, putative [Ricinus commu... 73 2e-11 ref|XP_004168581.1| PREDICTED: uncharacterized LOC101203034 [Cuc... 70 2e-10 ref|XP_004149436.1| PREDICTED: uncharacterized protein LOC101203... 70 2e-10 >ref|XP_002306655.1| predicted protein [Populus trichocarpa] gi|222856104|gb|EEE93651.1| predicted protein [Populus trichocarpa] Length = 697 Score = 73.9 bits (180), Expect = 1e-11 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -3 Query: 128 KLDSLSRELLTWALVKVAHPGDRVIALHVLENNEIVDRDGKS 3 KLD SRELLTWALVKVA PGD VIALH+L+NNEIVDR+GKS Sbjct: 14 KLDPASRELLTWALVKVAQPGDTVIALHILDNNEIVDREGKS 55 >ref|XP_002302218.1| predicted protein [Populus trichocarpa] gi|222843944|gb|EEE81491.1| predicted protein [Populus trichocarpa] Length = 738 Score = 73.9 bits (180), Expect = 1e-11 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -3 Query: 128 KLDSLSRELLTWALVKVAHPGDRVIALHVLENNEIVDRDGKS 3 KLDS+SRELLTWALVKVA PGD VIALHVL +NEIVDR+GKS Sbjct: 14 KLDSMSRELLTWALVKVAQPGDTVIALHVLGSNEIVDREGKS 55 >ref|XP_002520305.1| ATP binding protein, putative [Ricinus communis] gi|223540524|gb|EEF42091.1| ATP binding protein, putative [Ricinus communis] Length = 758 Score = 73.2 bits (178), Expect = 2e-11 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -3 Query: 128 KLDSLSRELLTWALVKVAHPGDRVIALHVLENNEIVDRDGKS 3 KLDS SRELLTWA+VKVA PGD VIALHVL NNEIVDR+GKS Sbjct: 23 KLDSESRELLTWAMVKVAQPGDTVIALHVLGNNEIVDREGKS 64 >ref|XP_004168581.1| PREDICTED: uncharacterized LOC101203034 [Cucumis sativus] Length = 756 Score = 69.7 bits (169), Expect = 2e-10 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -3 Query: 128 KLDSLSRELLTWALVKVAHPGDRVIALHVLENNEIVDRDGKS 3 KLDS SRELLTWALVKVA PGD VIALHVL N+EIV++DGKS Sbjct: 26 KLDSHSRELLTWALVKVAQPGDLVIALHVLGNHEIVNQDGKS 67 >ref|XP_004149436.1| PREDICTED: uncharacterized protein LOC101203034 [Cucumis sativus] Length = 756 Score = 69.7 bits (169), Expect = 2e-10 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -3 Query: 128 KLDSLSRELLTWALVKVAHPGDRVIALHVLENNEIVDRDGKS 3 KLDS SRELLTWALVKVA PGD VIALHVL N+EIV++DGKS Sbjct: 26 KLDSHSRELLTWALVKVAQPGDLVIALHVLGNHEIVNQDGKS 67