BLASTX nr result
ID: Scutellaria24_contig00015920
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00015920 (239 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631606.1| PREDICTED: BURP domain-containing protein 17... 61 8e-08 >ref|XP_003631606.1| PREDICTED: BURP domain-containing protein 17-like [Vitis vinifera] Length = 281 Score = 61.2 bits (147), Expect = 8e-08 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = +1 Query: 1 HVAFKMLGAQPGSSPICHFFPADNFVCVPSTALMQ 105 HV+F++LG QPG+SP+CHFFPADN + VPS AL+Q Sbjct: 246 HVSFRLLGVQPGASPVCHFFPADNLIWVPSPALIQ 280