BLASTX nr result
ID: Scutellaria24_contig00015818
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00015818 (703 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002331674.1| f-box family protein [Populus trichocarpa] g... 71 2e-10 ref|XP_002300154.1| predicted protein [Populus trichocarpa] gi|2... 69 9e-10 ref|XP_002327664.1| predicted protein [Populus trichocarpa] gi|2... 67 3e-09 ref|XP_002318138.1| predicted protein [Populus trichocarpa] gi|2... 67 5e-09 ref|XP_002318137.1| predicted protein [Populus trichocarpa] gi|2... 67 5e-09 >ref|XP_002331674.1| f-box family protein [Populus trichocarpa] gi|222874093|gb|EEF11224.1| f-box family protein [Populus trichocarpa] Length = 441 Score = 71.2 bits (173), Expect = 2e-10 Identities = 28/41 (68%), Positives = 37/41 (90%) Frame = +3 Query: 567 LPEDVIVDVLSKLPVKSLLRFKCVCKSWYGIISDPTFVLKH 689 LPEDV++++LS+LPVK+LL+FKCVCKSWY II+ P F+ KH Sbjct: 42 LPEDVVIEILSRLPVKNLLQFKCVCKSWYAIITSPNFISKH 82 >ref|XP_002300154.1| predicted protein [Populus trichocarpa] gi|222847412|gb|EEE84959.1| predicted protein [Populus trichocarpa] Length = 372 Score = 68.9 bits (167), Expect = 9e-10 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = +3 Query: 567 LPEDVIVDVLSKLPVKSLLRFKCVCKSWYGIISDPTFVLKHRET 698 LP+D++VD+L+ LPVKSLLRFKCVCK W+ +ISDP FV H +T Sbjct: 4 LPQDIMVDILTYLPVKSLLRFKCVCKLWHSLISDPKFVKSHLKT 47 >ref|XP_002327664.1| predicted protein [Populus trichocarpa] gi|222836749|gb|EEE75142.1| predicted protein [Populus trichocarpa] Length = 443 Score = 67.0 bits (162), Expect = 3e-09 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = +3 Query: 567 LPEDVIVDVLSKLPVKSLLRFKCVCKSWYGIISDPTFVLKH 689 LPEDVI+++LS+LPVK+LL+FKCVCKSW+ II+ P + KH Sbjct: 45 LPEDVIIEILSRLPVKNLLQFKCVCKSWHAIITSPKLISKH 85 >ref|XP_002318138.1| predicted protein [Populus trichocarpa] gi|222858811|gb|EEE96358.1| predicted protein [Populus trichocarpa] Length = 272 Score = 66.6 bits (161), Expect = 5e-09 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = +3 Query: 567 LPEDVIVDVLSKLPVKSLLRFKCVCKSWYGIISDPTFVLKH 689 LPEDVI+++LS LPVK+LL+FKCVCKSWYGII+ F+ H Sbjct: 9 LPEDVIIEILSLLPVKTLLQFKCVCKSWYGIITSSNFISLH 49 >ref|XP_002318137.1| predicted protein [Populus trichocarpa] gi|222858810|gb|EEE96357.1| predicted protein [Populus trichocarpa] Length = 367 Score = 66.6 bits (161), Expect = 5e-09 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = +3 Query: 567 LPEDVIVDVLSKLPVKSLLRFKCVCKSWYGIISDPTFVLKH 689 LPEDVI+++LS LPVK+LL+FKCVCKSWYGII+ F+ H Sbjct: 9 LPEDVIIEILSLLPVKTLLQFKCVCKSWYGIITSSNFISLH 49