BLASTX nr result
ID: Scutellaria24_contig00015609
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00015609 (472 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004141981.1| PREDICTED: probable mediator of RNA polymera... 65 7e-09 ref|XP_002265433.2| PREDICTED: uncharacterized protein LOC100262... 64 1e-08 ref|XP_002279496.2| PREDICTED: uncharacterized protein LOC100260... 62 5e-08 ref|XP_002279514.1| PREDICTED: uncharacterized protein LOC100260... 62 5e-08 emb|CBI37628.3| unnamed protein product [Vitis vinifera] 62 5e-08 >ref|XP_004141981.1| PREDICTED: probable mediator of RNA polymerase II transcription subunit 26c-like [Cucumis sativus] gi|449528150|ref|XP_004171069.1| PREDICTED: probable mediator of RNA polymerase II transcription subunit 26c-like [Cucumis sativus] Length = 345 Score = 64.7 bits (156), Expect = 7e-09 Identities = 32/37 (86%), Positives = 32/37 (86%), Gaps = 3/37 (8%) Frame = -1 Query: 472 AKRQRTIQVMDIHEIPKPKNTFFSKNK---GGFQGRH 371 AKRQRTIQVMDIHEIPKPKN FFSKNK GG QGRH Sbjct: 308 AKRQRTIQVMDIHEIPKPKNAFFSKNKGSGGGSQGRH 344 >ref|XP_002265433.2| PREDICTED: uncharacterized protein LOC100262291 [Vitis vinifera] gi|296081186|emb|CBI18212.3| unnamed protein product [Vitis vinifera] Length = 332 Score = 64.3 bits (155), Expect = 1e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -1 Query: 472 AKRQRTIQVMDIHEIPKPKNTFFSKNKGGFQGRH 371 AK+QRTIQVMDIH+IPKPKNTFF+KN+GG Q +H Sbjct: 298 AKKQRTIQVMDIHDIPKPKNTFFAKNRGGVQAKH 331 >ref|XP_002279496.2| PREDICTED: uncharacterized protein LOC100260896 isoform 1 [Vitis vinifera] Length = 331 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 472 AKRQRTIQVMDIHEIPKPKNTFFSKNKGGFQGRH 371 AK+QRTIQVMDIH+IPKPKNTFF+K K G QGRH Sbjct: 297 AKKQRTIQVMDIHDIPKPKNTFFAKPKVGSQGRH 330 >ref|XP_002279514.1| PREDICTED: uncharacterized protein LOC100260896 isoform 2 [Vitis vinifera] Length = 305 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 472 AKRQRTIQVMDIHEIPKPKNTFFSKNKGGFQGRH 371 AK+QRTIQVMDIH+IPKPKNTFF+K K G QGRH Sbjct: 271 AKKQRTIQVMDIHDIPKPKNTFFAKPKVGSQGRH 304 >emb|CBI37628.3| unnamed protein product [Vitis vinifera] Length = 332 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 472 AKRQRTIQVMDIHEIPKPKNTFFSKNKGGFQGRH 371 AK+QRTIQVMDIH+IPKPKNTFF+K K G QGRH Sbjct: 298 AKKQRTIQVMDIHDIPKPKNTFFAKPKVGSQGRH 331