BLASTX nr result
ID: Scutellaria24_contig00015553
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00015553 (493 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI37724.3| unnamed protein product [Vitis vinifera] 65 4e-09 ref|XP_002279974.1| PREDICTED: pentatricopeptide repeat-containi... 65 4e-09 ref|XP_003524101.1| PREDICTED: pentatricopeptide repeat-containi... 63 2e-08 ref|NP_178481.1| pentatricopeptide repeat-containing protein [Ar... 62 4e-08 ref|XP_002328140.1| predicted protein [Populus trichocarpa] gi|2... 62 6e-08 >emb|CBI37724.3| unnamed protein product [Vitis vinifera] Length = 339 Score = 65.5 bits (158), Expect = 4e-09 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 3 ANMENRSIVIRDPIRYHHFQDGACSCGDYW 92 + ME+RSIVIRDPIRYHHFQDG CSCGDYW Sbjct: 310 SRMEHRSIVIRDPIRYHHFQDGVCSCGDYW 339 >ref|XP_002279974.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Vitis vinifera] Length = 623 Score = 65.5 bits (158), Expect = 4e-09 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 3 ANMENRSIVIRDPIRYHHFQDGACSCGDYW 92 + ME+RSIVIRDPIRYHHFQDG CSCGDYW Sbjct: 594 SRMEHRSIVIRDPIRYHHFQDGVCSCGDYW 623 >ref|XP_003524101.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Glycine max] Length = 854 Score = 63.2 bits (152), Expect = 2e-08 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 3 ANMENRSIVIRDPIRYHHFQDGACSCGDYW 92 A +E R IVIRDPIRYHHFQDG CSCGDYW Sbjct: 825 AELEQRHIVIRDPIRYHHFQDGVCSCGDYW 854 >ref|NP_178481.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75206038|sp|Q9SI53.1|PP147_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g03880, mitochondrial; Flags: Precursor gi|4582435|gb|AAD24821.1| putative selenium-binding protein [Arabidopsis thaliana] gi|330250668|gb|AEC05762.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 630 Score = 62.4 bits (150), Expect = 4e-08 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 3 ANMENRSIVIRDPIRYHHFQDGACSCGDYW 92 + +E RSIVIRDPIRYHHFQDG CSCGDYW Sbjct: 601 SKLEIRSIVIRDPIRYHHFQDGKCSCGDYW 630 >ref|XP_002328140.1| predicted protein [Populus trichocarpa] gi|222837655|gb|EEE76020.1| predicted protein [Populus trichocarpa] Length = 534 Score = 61.6 bits (148), Expect = 6e-08 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +3 Query: 3 ANMENRSIVIRDPIRYHHFQDGACSCGDYW 92 A ME R IVIRDP+RYHHFQDG CSCGD+W Sbjct: 505 AKMEQRIIVIRDPVRYHHFQDGLCSCGDFW 534