BLASTX nr result
ID: Scutellaria24_contig00015426
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00015426 (680 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516785.1| conserved hypothetical protein [Ricinus comm... 60 5e-07 ref|XP_002320393.1| predicted protein [Populus trichocarpa] gi|2... 55 1e-05 >ref|XP_002516785.1| conserved hypothetical protein [Ricinus communis] gi|223543873|gb|EEF45399.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 59.7 bits (143), Expect = 5e-07 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +1 Query: 214 KFRSWQKCSRFIQEQRTRLYIVWRCSVILI 303 KFRSWQ+CSR ++EQRTRLYI+WRC+VIL+ Sbjct: 13 KFRSWQRCSRLVKEQRTRLYIIWRCTVILL 42 >ref|XP_002320393.1| predicted protein [Populus trichocarpa] gi|222861166|gb|EEE98708.1| predicted protein [Populus trichocarpa] Length = 64 Score = 55.5 bits (132), Expect = 1e-05 Identities = 24/50 (48%), Positives = 38/50 (76%), Gaps = 4/50 (8%) Frame = +1 Query: 166 STNQDSELII----MGLTRQKFRSWQKCSRFIQEQRTRLYIVWRCSVILI 303 ST Q++++ + + + K RSWQ+CS+ I+EQRTRLYI+WRC+V+L+ Sbjct: 11 STAQETKIQMAADALSMRSMKLRSWQRCSKQIREQRTRLYIIWRCTVMLL 60