BLASTX nr result
ID: Scutellaria24_contig00015273
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00015273 (271 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522054.1| conserved hypothetical protein [Ricinus comm... 65 6e-09 ref|XP_002530605.1| Magnesium and cobalt efflux protein corC, pu... 64 1e-08 ref|XP_003593351.1| CBS domain containing protein [Medicago trun... 64 1e-08 ref|XP_002313203.1| predicted protein [Populus trichocarpa] gi|2... 62 4e-08 ref|XP_003635392.1| PREDICTED: DUF21 domain-containing protein A... 62 5e-08 >ref|XP_002522054.1| conserved hypothetical protein [Ricinus communis] gi|223538653|gb|EEF40254.1| conserved hypothetical protein [Ricinus communis] Length = 425 Score = 65.1 bits (157), Expect = 6e-09 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +1 Query: 166 MAVEYRCCETGFFIRIAVIVFLVLFAGLMSGLTLG 270 MAVEY+CCET FFI I VIVFLVLFAGLMSGLTLG Sbjct: 1 MAVEYKCCETEFFIHIVVIVFLVLFAGLMSGLTLG 35 >ref|XP_002530605.1| Magnesium and cobalt efflux protein corC, putative [Ricinus communis] gi|223529853|gb|EEF31785.1| Magnesium and cobalt efflux protein corC, putative [Ricinus communis] Length = 429 Score = 64.3 bits (155), Expect = 1e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +1 Query: 166 MAVEYRCCETGFFIRIAVIVFLVLFAGLMSGLTLG 270 MA+EY CC TGFFI IAV+VFLVLFAGLMSGLTLG Sbjct: 1 MAIEYVCCGTGFFIHIAVVVFLVLFAGLMSGLTLG 35 >ref|XP_003593351.1| CBS domain containing protein [Medicago truncatula] gi|355482399|gb|AES63602.1| CBS domain containing protein [Medicago truncatula] Length = 429 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +1 Query: 166 MAVEYRCCETGFFIRIAVIVFLVLFAGLMSGLTLG 270 MAVEYRCCET FFIRI +IV LV+FAGLMSGLTLG Sbjct: 1 MAVEYRCCETEFFIRIMIIVLLVVFAGLMSGLTLG 35 >ref|XP_002313203.1| predicted protein [Populus trichocarpa] gi|222849611|gb|EEE87158.1| predicted protein [Populus trichocarpa] Length = 430 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +1 Query: 166 MAVEYRCCETGFFIRIAVIVFLVLFAGLMSGLTLG 270 MAVEY+CCET FF+ I +IV LVLFAGLMSGLTLG Sbjct: 1 MAVEYKCCETDFFVNIVIIVLLVLFAGLMSGLTLG 35 >ref|XP_003635392.1| PREDICTED: DUF21 domain-containing protein At2g14520-like isoform 2 [Vitis vinifera] Length = 419 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +1 Query: 166 MAVEYRCCETGFFIRIAVIVFLVLFAGLMSGLTLG 270 MAVEYRCC TGFF+ I++I LVLFAGLMSGLTLG Sbjct: 1 MAVEYRCCGTGFFLHISIIALLVLFAGLMSGLTLG 35