BLASTX nr result
ID: Scutellaria24_contig00015228
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00015228 (328 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002322208.1| predicted protein [Populus trichocarpa] gi|2... 64 1e-08 ref|XP_003601149.1| Serine/threonine protein kinase AFC2 [Medica... 63 2e-08 gb|ACJ85645.1| unknown [Medicago truncatula] 63 2e-08 ref|XP_002322829.1| predicted protein [Populus trichocarpa] gi|2... 63 3e-08 ref|XP_002511301.1| afc, putative [Ricinus communis] gi|22355041... 62 4e-08 >ref|XP_002322208.1| predicted protein [Populus trichocarpa] gi|222869204|gb|EEF06335.1| predicted protein [Populus trichocarpa] Length = 427 Score = 63.9 bits (154), Expect = 1e-08 Identities = 32/46 (69%), Positives = 35/46 (76%) Frame = -3 Query: 140 LLFCVDFSHLYSISSVMHDLHLIHTDLKPENILLVSSDYLRVPDYK 3 LL CV F MHDLH+IHTDLKPENILLVSSDY++VPDYK Sbjct: 202 LLECVAF---------MHDLHMIHTDLKPENILLVSSDYVKVPDYK 238 >ref|XP_003601149.1| Serine/threonine protein kinase AFC2 [Medicago truncatula] gi|355490197|gb|AES71400.1| Serine/threonine protein kinase AFC2 [Medicago truncatula] Length = 426 Score = 63.2 bits (152), Expect = 2e-08 Identities = 31/46 (67%), Positives = 35/46 (76%) Frame = -3 Query: 140 LLFCVDFSHLYSISSVMHDLHLIHTDLKPENILLVSSDYLRVPDYK 3 LL CV F MHDLH+IHTDLKPENILLVSS+YL++PDYK Sbjct: 203 LLECVAF---------MHDLHMIHTDLKPENILLVSSEYLKIPDYK 239 >gb|ACJ85645.1| unknown [Medicago truncatula] Length = 327 Score = 63.2 bits (152), Expect = 2e-08 Identities = 31/46 (67%), Positives = 35/46 (76%) Frame = -3 Query: 140 LLFCVDFSHLYSISSVMHDLHLIHTDLKPENILLVSSDYLRVPDYK 3 LL CV F MHDLH+IHTDLKPENILLVSS+YL++PDYK Sbjct: 104 LLECVAF---------MHDLHMIHTDLKPENILLVSSEYLKIPDYK 140 >ref|XP_002322829.1| predicted protein [Populus trichocarpa] gi|222867459|gb|EEF04590.1| predicted protein [Populus trichocarpa] Length = 433 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 92 MHDLHLIHTDLKPENILLVSSDYLRVPDYK 3 MHDLHLIHTDLKPENILLVSS+Y++VPDYK Sbjct: 210 MHDLHLIHTDLKPENILLVSSEYIKVPDYK 239 >ref|XP_002511301.1| afc, putative [Ricinus communis] gi|223550416|gb|EEF51903.1| afc, putative [Ricinus communis] Length = 435 Score = 62.4 bits (150), Expect = 4e-08 Identities = 31/46 (67%), Positives = 34/46 (73%) Frame = -3 Query: 140 LLFCVDFSHLYSISSVMHDLHLIHTDLKPENILLVSSDYLRVPDYK 3 LL C+ F MHDLHLIHTDLKPENILLVS DY++VPDYK Sbjct: 210 LLECIAF---------MHDLHLIHTDLKPENILLVSPDYVKVPDYK 246