BLASTX nr result
ID: Scutellaria24_contig00015147
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00015147 (258 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301062.1| predicted protein [Populus trichocarpa] gi|2... 91 1e-16 gb|ABK93831.1| unknown [Populus trichocarpa] gi|118487520|gb|ABK... 91 1e-16 dbj|BAA33810.1| phi-1 [Nicotiana tabacum] 91 1e-16 ref|XP_002513943.1| conserved hypothetical protein [Ricinus comm... 90 2e-16 ref|XP_002513944.1| conserved hypothetical protein [Ricinus comm... 90 2e-16 >ref|XP_002301062.1| predicted protein [Populus trichocarpa] gi|222842788|gb|EEE80335.1| predicted protein [Populus trichocarpa] Length = 319 Score = 90.9 bits (224), Expect = 1e-16 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = +2 Query: 2 AYPGYAGNLLVESTTGASYNAHGTNGRKYLLPAIYDPSTSKCSTLV 139 AYPGYAG+LLV+STTGASYNAHG+NGRKYLLPA+YDPSTS CSTLV Sbjct: 274 AYPGYAGSLLVDSTTGASYNAHGSNGRKYLLPALYDPSTSTCSTLV 319 >gb|ABK93831.1| unknown [Populus trichocarpa] gi|118487520|gb|ABK95587.1| unknown [Populus trichocarpa] Length = 319 Score = 90.9 bits (224), Expect = 1e-16 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = +2 Query: 2 AYPGYAGNLLVESTTGASYNAHGTNGRKYLLPAIYDPSTSKCSTLV 139 AYPGYAG+LLV+STTGASYNAHG+NGRKYLLPA+YDPSTS CSTLV Sbjct: 274 AYPGYAGSLLVDSTTGASYNAHGSNGRKYLLPALYDPSTSTCSTLV 319 >dbj|BAA33810.1| phi-1 [Nicotiana tabacum] Length = 313 Score = 90.9 bits (224), Expect = 1e-16 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = +2 Query: 2 AYPGYAGNLLVESTTGASYNAHGTNGRKYLLPAIYDPSTSKCSTLV 139 AYPGYAG+LLV+ TTGASYNAHGTNGRKYLLPA+YDPSTS CSTLV Sbjct: 268 AYPGYAGDLLVDKTTGASYNAHGTNGRKYLLPALYDPSTSTCSTLV 313 >ref|XP_002513943.1| conserved hypothetical protein [Ricinus communis] gi|223547029|gb|EEF48526.1| conserved hypothetical protein [Ricinus communis] Length = 317 Score = 90.1 bits (222), Expect = 2e-16 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = +2 Query: 2 AYPGYAGNLLVESTTGASYNAHGTNGRKYLLPAIYDPSTSKCSTLV 139 AYPGYAGNLLV+STTGASYNA+G NGRKYLLPA+YDPSTS CSTLV Sbjct: 272 AYPGYAGNLLVDSTTGASYNAYGDNGRKYLLPALYDPSTSSCSTLV 317 >ref|XP_002513944.1| conserved hypothetical protein [Ricinus communis] gi|223547030|gb|EEF48527.1| conserved hypothetical protein [Ricinus communis] Length = 317 Score = 89.7 bits (221), Expect = 2e-16 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = +2 Query: 2 AYPGYAGNLLVESTTGASYNAHGTNGRKYLLPAIYDPSTSKCSTLV 139 AYPGYAGNLLV++TTGASYNAHG NGRKYLLPA++DPSTS CSTLV Sbjct: 272 AYPGYAGNLLVDTTTGASYNAHGVNGRKYLLPALFDPSTSTCSTLV 317