BLASTX nr result
ID: Scutellaria24_contig00015107
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00015107 (201 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002331379.1| nbs-lrr resistance protein [Populus trichoca... 59 5e-07 ref|XP_002320002.1| predicted protein [Populus trichocarpa] gi|2... 59 5e-07 ref|XP_002320669.1| predicted protein [Populus trichocarpa] gi|2... 58 9e-07 ref|XP_002333421.1| cc-nbs-lrr resistance protein [Populus trich... 58 9e-07 ref|XP_002332557.1| nbs-lrr resistance protein [Populus trichoca... 57 1e-06 >ref|XP_002331379.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222874417|gb|EEF11548.1| nbs-lrr resistance protein [Populus trichocarpa] Length = 821 Score = 58.5 bits (140), Expect = 5e-07 Identities = 30/50 (60%), Positives = 36/50 (72%) Frame = -3 Query: 151 FKSLHTLILMDSDLKELPSSINELLHLRYLQISPRGIQDLPDSIGDLYHL 2 FKSL TL L +SD+ ELP SI +L HLRYL +S I+ LP+SI LYHL Sbjct: 365 FKSLRTLKLQESDITELPDSICKLRHLRYLDVSVPAIRVLPESITKLYHL 414 >ref|XP_002320002.1| predicted protein [Populus trichocarpa] gi|222860775|gb|EEE98317.1| predicted protein [Populus trichocarpa] Length = 855 Score = 58.5 bits (140), Expect = 5e-07 Identities = 30/50 (60%), Positives = 36/50 (72%) Frame = -3 Query: 151 FKSLHTLILMDSDLKELPSSINELLHLRYLQISPRGIQDLPDSIGDLYHL 2 FKSL TL L SD+ ELP SI +L HLRYL +S I++LP+SI LYHL Sbjct: 71 FKSLRTLKLQRSDITELPDSICKLRHLRYLDVSRTRIRELPESITKLYHL 120 >ref|XP_002320669.1| predicted protein [Populus trichocarpa] gi|222861442|gb|EEE98984.1| predicted protein [Populus trichocarpa] Length = 914 Score = 57.8 bits (138), Expect = 9e-07 Identities = 30/50 (60%), Positives = 35/50 (70%) Frame = -3 Query: 151 FKSLHTLILMDSDLKELPSSINELLHLRYLQISPRGIQDLPDSIGDLYHL 2 FKSL TL L SD+ ELP SI +L HLRYL +S I+ LP+SI LYHL Sbjct: 116 FKSLRTLKLKKSDIIELPDSIYKLRHLRYLDVSDTAIRALPESITKLYHL 165 Score = 57.8 bits (138), Expect = 9e-07 Identities = 30/50 (60%), Positives = 35/50 (70%) Frame = -3 Query: 151 FKSLHTLILMDSDLKELPSSINELLHLRYLQISPRGIQDLPDSIGDLYHL 2 FKSL TL L SD+ ELP SI +L HLRYL +S I+ LP+SI LYHL Sbjct: 298 FKSLRTLKLKKSDIIELPDSIYKLRHLRYLDVSDTAIRALPESITKLYHL 347 >ref|XP_002333421.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|105922514|gb|ABF81421.1| NBS-LRR type disease resistance protein [Populus trichocarpa] gi|222836549|gb|EEE74956.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Length = 1177 Score = 57.8 bits (138), Expect = 9e-07 Identities = 30/50 (60%), Positives = 36/50 (72%) Frame = -3 Query: 151 FKSLHTLILMDSDLKELPSSINELLHLRYLQISPRGIQDLPDSIGDLYHL 2 FKSL TL L SD+ ELP SI +L HLRYL +S I++LP+SI LYHL Sbjct: 556 FKSLRTLKLQRSDVTELPGSICKLRHLRYLDVSCTRIRELPESITKLYHL 605 >ref|XP_002332557.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222833033|gb|EEE71510.1| nbs-lrr resistance protein [Populus trichocarpa] Length = 1027 Score = 57.4 bits (137), Expect = 1e-06 Identities = 30/50 (60%), Positives = 35/50 (70%) Frame = -3 Query: 151 FKSLHTLILMDSDLKELPSSINELLHLRYLQISPRGIQDLPDSIGDLYHL 2 FKSL TL L SD+ ELP SI +L HLRYL +S I+ LP+SI LYHL Sbjct: 409 FKSLRTLKLRRSDITELPDSICKLRHLRYLDVSDTAIRVLPESITKLYHL 458