BLASTX nr result
ID: Scutellaria24_contig00015066
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00015066 (389 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301436.1| predicted protein [Populus trichocarpa] gi|2... 90 2e-16 ref|XP_002529975.1| acyltransferase, putative [Ricinus communis]... 87 1e-15 gb|AET83339.1| hypothetical protein, partial [Pinus contorta var... 85 5e-15 gb|AET83309.1| hypothetical protein, partial [Pinus contorta var... 85 5e-15 emb|CBI38700.3| unnamed protein product [Vitis vinifera] 85 7e-15 >ref|XP_002301436.1| predicted protein [Populus trichocarpa] gi|222843162|gb|EEE80709.1| predicted protein [Populus trichocarpa] Length = 522 Score = 90.1 bits (222), Expect = 2e-16 Identities = 39/50 (78%), Positives = 44/50 (88%) Frame = +2 Query: 2 GNRVWQIAFGSGFKCNSAVWKALREIPAKESKANPWFDCVDKYPVHIPNS 151 G+RVWQIAFGSGFKCNSAVWKALREIPA ESK NPW D +D YPV +P++ Sbjct: 473 GDRVWQIAFGSGFKCNSAVWKALREIPAGESKGNPWNDSIDWYPVKVPSA 522 >ref|XP_002529975.1| acyltransferase, putative [Ricinus communis] gi|223530537|gb|EEF32418.1| acyltransferase, putative [Ricinus communis] Length = 527 Score = 87.0 bits (214), Expect = 1e-15 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = +2 Query: 2 GNRVWQIAFGSGFKCNSAVWKALREIPAKESKANPWFDCVDKYPVHIP 145 G+RVWQIAFGSGFKCNSAVWKALR IP ES++NPW D +D+YPV +P Sbjct: 478 GDRVWQIAFGSGFKCNSAVWKALRAIPCGESRSNPWADSIDRYPVKVP 525 >gb|AET83339.1| hypothetical protein, partial [Pinus contorta var. bolanderi] Length = 112 Score = 85.1 bits (209), Expect = 5e-15 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = +2 Query: 2 GNRVWQIAFGSGFKCNSAVWKALREIPAKESKANPWFDCVDKYPVHIP 145 G+R+WQIAFGSGFKCNSAVWKALR + AK K NPWFDC+D YPV +P Sbjct: 64 GDRLWQIAFGSGFKCNSAVWKALRPVQAKSPK-NPWFDCIDNYPVKVP 110 >gb|AET83309.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534513|gb|AET83310.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534515|gb|AET83311.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534517|gb|AET83312.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534519|gb|AET83313.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534521|gb|AET83314.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534523|gb|AET83315.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534525|gb|AET83316.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534527|gb|AET83317.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534529|gb|AET83318.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534531|gb|AET83319.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534533|gb|AET83320.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534535|gb|AET83321.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534537|gb|AET83322.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534539|gb|AET83323.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534541|gb|AET83324.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534543|gb|AET83325.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534545|gb|AET83326.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534547|gb|AET83327.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534549|gb|AET83328.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534551|gb|AET83329.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534553|gb|AET83330.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534555|gb|AET83331.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534557|gb|AET83332.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534559|gb|AET83333.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534561|gb|AET83334.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534563|gb|AET83335.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534565|gb|AET83336.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534567|gb|AET83337.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534569|gb|AET83338.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534573|gb|AET83340.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534575|gb|AET83341.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534577|gb|AET83342.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534579|gb|AET83343.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534581|gb|AET83344.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534583|gb|AET83345.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534585|gb|AET83346.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534587|gb|AET83347.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534589|gb|AET83348.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534591|gb|AET83349.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534593|gb|AET83350.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534595|gb|AET83351.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534597|gb|AET83352.1| hypothetical protein, partial [Pinus contorta var. murrayana] gi|357534599|gb|AET83353.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534601|gb|AET83354.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534603|gb|AET83355.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534605|gb|AET83356.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534607|gb|AET83357.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534609|gb|AET83358.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534611|gb|AET83359.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534613|gb|AET83360.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534615|gb|AET83361.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534617|gb|AET83362.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534619|gb|AET83363.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534621|gb|AET83364.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534623|gb|AET83365.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534625|gb|AET83366.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534627|gb|AET83367.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534629|gb|AET83368.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534631|gb|AET83369.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534633|gb|AET83370.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534635|gb|AET83371.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534637|gb|AET83372.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534639|gb|AET83373.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534641|gb|AET83374.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534643|gb|AET83375.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534645|gb|AET83376.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534647|gb|AET83377.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534649|gb|AET83378.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534651|gb|AET83379.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534653|gb|AET83380.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534655|gb|AET83381.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534657|gb|AET83382.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534659|gb|AET83383.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534661|gb|AET83384.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534663|gb|AET83385.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534665|gb|AET83386.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534667|gb|AET83387.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534669|gb|AET83388.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534671|gb|AET83389.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534673|gb|AET83390.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534675|gb|AET83391.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534677|gb|AET83392.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534679|gb|AET83393.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534681|gb|AET83394.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534683|gb|AET83395.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534685|gb|AET83396.1| hypothetical protein, partial [Pinus contorta var. murrayana] gi|361068029|gb|AEW08326.1| Pinus taeda anonymous locus 2_6428_01 genomic sequence gi|383166407|gb|AFG66151.1| Pinus taeda anonymous locus 2_6428_01 genomic sequence gi|383166409|gb|AFG66152.1| Pinus taeda anonymous locus 2_6428_01 genomic sequence gi|383166411|gb|AFG66153.1| Pinus taeda anonymous locus 2_6428_01 genomic sequence gi|383166413|gb|AFG66154.1| Pinus taeda anonymous locus 2_6428_01 genomic sequence gi|383166415|gb|AFG66155.1| Pinus taeda anonymous locus 2_6428_01 genomic sequence gi|383166417|gb|AFG66156.1| Pinus taeda anonymous locus 2_6428_01 genomic sequence gi|383166419|gb|AFG66157.1| Pinus taeda anonymous locus 2_6428_01 genomic sequence gi|383166421|gb|AFG66158.1| Pinus taeda anonymous locus 2_6428_01 genomic sequence gi|383166423|gb|AFG66159.1| Pinus taeda anonymous locus 2_6428_01 genomic sequence gi|383166425|gb|AFG66160.1| Pinus taeda anonymous locus 2_6428_01 genomic sequence gi|383166427|gb|AFG66161.1| Pinus taeda anonymous locus 2_6428_01 genomic sequence gi|383166429|gb|AFG66162.1| Pinus taeda anonymous locus 2_6428_01 genomic sequence gi|383166431|gb|AFG66163.1| Pinus taeda anonymous locus 2_6428_01 genomic sequence gi|383166433|gb|AFG66164.1| Pinus taeda anonymous locus 2_6428_01 genomic sequence gi|383166435|gb|AFG66165.1| Pinus taeda anonymous locus 2_6428_01 genomic sequence gi|383166437|gb|AFG66166.1| Pinus taeda anonymous locus 2_6428_01 genomic sequence Length = 125 Score = 85.1 bits (209), Expect = 5e-15 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = +2 Query: 2 GNRVWQIAFGSGFKCNSAVWKALREIPAKESKANPWFDCVDKYPVHIP 145 G+R+WQIAFGSGFKCNSAVWKALR + AK K NPWFDC+D YPV +P Sbjct: 77 GDRLWQIAFGSGFKCNSAVWKALRPVQAKSPK-NPWFDCIDNYPVKVP 123 >emb|CBI38700.3| unnamed protein product [Vitis vinifera] Length = 714 Score = 84.7 bits (208), Expect = 7e-15 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = +2 Query: 2 GNRVWQIAFGSGFKCNSAVWKALREIPAKESKANPWFDCVDKYPVHIP 145 G+RVWQIAFGSGFKCNSAVW++LREIP ES NPW D VD+YPV +P Sbjct: 488 GDRVWQIAFGSGFKCNSAVWRSLREIPVGESGDNPWADSVDRYPVKVP 535