BLASTX nr result
ID: Scutellaria24_contig00014903
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00014903 (682 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P25469.1|H2A1_SOLLC RecName: Full=Histone H2A.1; AltName: Ful... 181 9e-44 dbj|BAL49713.1| fusion protein of histone 2A and enhanced yellow... 181 9e-44 dbj|BAC53941.1| H2A histone [Nicotiana tabacum] 180 3e-43 ref|XP_002318994.1| histone 2 [Populus trichocarpa] gi|222857370... 171 2e-40 ref|XP_003626258.1| Histone H2A [Medicago truncatula] gi|1243600... 170 2e-40 >sp|P25469.1|H2A1_SOLLC RecName: Full=Histone H2A.1; AltName: Full=LeH2A-1 gi|355477218|gb|AES12482.1| putative histone 2A protein [Solanum lycopersicum] Length = 146 Score = 181 bits (460), Expect = 9e-44 Identities = 97/146 (66%), Positives = 112/146 (76%), Gaps = 3/146 (2%) Frame = -3 Query: 611 VDTNTTTKFAXXXXXXXRKKAIPKSVKAGLQFPVGRIARFLKRGRYAQRMGTGAPIYMXX 432 +D TTK A RKK++ KS+KAGLQFPVGRI R+LK+GRYAQR+G+GAPIY+ Sbjct: 1 MDATKTTKGAGGRKGGPRKKSVTKSIKAGLQFPVGRIGRYLKKGRYAQRVGSGAPIYLAA 60 Query: 431 XXXXXXXXXXXXAGNAARDNKKSRIIPRHVQLAIRNDDELGKLLNGVTIASGGVLPNINP 252 AGNAARDNKKSRIIPRHV LA+RND+ELGKLL GVTIASGGVLPNINP Sbjct: 61 VLEYLAAEVLELAGNAARDNKKSRIIPRHVLLAVRNDEELGKLLAGVTIASGGVLPNINP 120 Query: 251 VLLPKKSAVSEDKAPQM---KSPAKA 183 VLLPKKSAV+E+K+P+ KSP KA Sbjct: 121 VLLPKKSAVAEEKSPKAKAGKSPKKA 146 >dbj|BAL49713.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00001] gi|374428674|dbj|BAL49716.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00002] gi|374428678|dbj|BAL49719.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00003] gi|374428682|dbj|BAL49722.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00004] gi|374428686|dbj|BAL49725.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00005] gi|374428690|dbj|BAL49728.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00006] gi|374428694|dbj|BAL49731.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00007] gi|374428698|dbj|BAL49734.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00008] gi|374428702|dbj|BAL49737.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00009] gi|374428706|dbj|BAL49740.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00010] gi|374428710|dbj|BAL49743.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00011] gi|374428714|dbj|BAL49746.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00012] gi|374428718|dbj|BAL49749.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00013] gi|374428722|dbj|BAL49752.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00014] gi|374428726|dbj|BAL49755.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00015] gi|374428730|dbj|BAL49758.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00016] gi|374428734|dbj|BAL49761.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00017] gi|374428738|dbj|BAL49764.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00018] gi|374428742|dbj|BAL49767.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00019] gi|374428748|dbj|BAL49770.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00020] gi|374428752|dbj|BAL49773.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00021] gi|374428756|dbj|BAL49776.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00022] gi|374428760|dbj|BAL49779.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00023] gi|374428764|dbj|BAL49782.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00024] gi|374428768|dbj|BAL49785.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00025] gi|374428772|dbj|BAL49788.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00026] gi|374428776|dbj|BAL49791.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00027] gi|374428780|dbj|BAL49794.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00028] gi|374428784|dbj|BAL49797.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00029] gi|374428788|dbj|BAL49800.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00030] gi|374428792|dbj|BAL49803.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00031] gi|374428796|dbj|BAL49806.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00032] Length = 387 Score = 181 bits (460), Expect = 9e-44 Identities = 97/146 (66%), Positives = 112/146 (76%), Gaps = 3/146 (2%) Frame = -3 Query: 611 VDTNTTTKFAXXXXXXXRKKAIPKSVKAGLQFPVGRIARFLKRGRYAQRMGTGAPIYMXX 432 +D TTK A RKK++ KS+KAGLQFPVGRI R+LK+GRYAQR+G+GAPIY+ Sbjct: 1 MDATKTTKGAGGRKGGPRKKSVTKSIKAGLQFPVGRIGRYLKKGRYAQRVGSGAPIYLAA 60 Query: 431 XXXXXXXXXXXXAGNAARDNKKSRIIPRHVQLAIRNDDELGKLLNGVTIASGGVLPNINP 252 AGNAARDNKKSRIIPRHV LA+RND+ELGKLL GVTIASGGVLPNINP Sbjct: 61 VLEYLAAEVLELAGNAARDNKKSRIIPRHVLLAVRNDEELGKLLAGVTIASGGVLPNINP 120 Query: 251 VLLPKKSAVSEDKAPQM---KSPAKA 183 VLLPKKSAV+E+K+P+ KSP KA Sbjct: 121 VLLPKKSAVAEEKSPKAKAGKSPKKA 146 >dbj|BAC53941.1| H2A histone [Nicotiana tabacum] Length = 148 Score = 180 bits (456), Expect = 3e-43 Identities = 99/148 (66%), Positives = 110/148 (74%), Gaps = 3/148 (2%) Frame = -3 Query: 617 MEVDTNTTTKFAXXXXXXXRKKAIPKSVKAGLQFPVGRIARFLKRGRYAQRMGTGAPIYM 438 ME T TT RKK++ KSVKAGLQFPVGRIARFLK+GRYAQR+G+GAPIY+ Sbjct: 1 MEAATKTTKGAGGRKGGGPRKKSVTKSVKAGLQFPVGRIARFLKKGRYAQRVGSGAPIYL 60 Query: 437 XXXXXXXXXXXXXXAGNAARDNKKSRIIPRHVQLAIRNDDELGKLLNGVTIASGGVLPNI 258 AGNAARDNKKSRIIPRHV LA+RND+ELGKLL+GVTIASGGVLPNI Sbjct: 61 AAVLEYLAAEVLELAGNAARDNKKSRIIPRHVLLAVRNDEELGKLLSGVTIASGGVLPNI 120 Query: 257 NPVLLPKKSAVSEDKA---PQMKSPAKA 183 NPVLLPKKSA +E+KA KSP KA Sbjct: 121 NPVLLPKKSAAAEEKASTPKATKSPKKA 148 >ref|XP_002318994.1| histone 2 [Populus trichocarpa] gi|222857370|gb|EEE94917.1| histone 2 [Populus trichocarpa] Length = 141 Score = 171 bits (432), Expect = 2e-40 Identities = 95/138 (68%), Positives = 103/138 (74%), Gaps = 1/138 (0%) Frame = -3 Query: 593 TKFAXXXXXXXRKKAIPKSVKAGLQFPVGRIARFLKRGRYAQRMGTGAPIYMXXXXXXXX 414 TK A RKK++ KS KAGLQFPVGRIARFLK+GRYAQR+G+GAPIYM Sbjct: 4 TKGAGGRRGGERKKSVSKSTKAGLQFPVGRIARFLKKGRYAQRVGSGAPIYMAAVLEYLA 63 Query: 413 XXXXXXAGNAARDNKKSRIIPRHVQLAIRNDDELGKLLNGVTIASGGVLPNINPVLLPKK 234 AGNAARDNKK+RI PRHV LAIRND+ELGKLL GVTIASGGVLPNINPVLLPKK Sbjct: 64 AEVLELAGNAARDNKKNRINPRHVLLAIRNDEELGKLLQGVTIASGGVLPNINPVLLPKK 123 Query: 233 SAVSE-DKAPQMKSPAKA 183 SA SE + KSP KA Sbjct: 124 SASSEKSSGSEPKSPKKA 141 >ref|XP_003626258.1| Histone H2A [Medicago truncatula] gi|124360019|gb|ABN08035.1| Histone H2A; Histone-fold [Medicago truncatula] gi|355501273|gb|AES82476.1| Histone H2A [Medicago truncatula] Length = 144 Score = 170 bits (431), Expect = 2e-40 Identities = 90/129 (69%), Positives = 100/129 (77%) Frame = -3 Query: 605 TNTTTKFAXXXXXXXRKKAIPKSVKAGLQFPVGRIARFLKRGRYAQRMGTGAPIYMXXXX 426 T TTTK A RKKA+ KS KAGLQFPVGRIARF+K+GRY+QR+GTGAPIY+ Sbjct: 8 TTTTTKGAGGRKGGERKKAVSKSSKAGLQFPVGRIARFMKKGRYSQRVGTGAPIYLAAVL 67 Query: 425 XXXXXXXXXXAGNAARDNKKSRIIPRHVQLAIRNDDELGKLLNGVTIASGGVLPNINPVL 246 AGNAARDNKK+RI PRHV LA+RNDDELGKLL GVTIASGGVLPNINPVL Sbjct: 68 EYLAAEVLELAGNAARDNKKNRINPRHVCLAVRNDDELGKLLQGVTIASGGVLPNINPVL 127 Query: 245 LPKKSAVSE 219 LPKK+A +E Sbjct: 128 LPKKTAAAE 136