BLASTX nr result
ID: Scutellaria24_contig00014764
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00014764 (430 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003589471.1| hypothetical protein MTR_1g024970 [Medicago ... 56 3e-06 >ref|XP_003589471.1| hypothetical protein MTR_1g024970 [Medicago truncatula] gi|355478519|gb|AES59722.1| hypothetical protein MTR_1g024970 [Medicago truncatula] Length = 143 Score = 56.2 bits (134), Expect = 3e-06 Identities = 29/95 (30%), Positives = 48/95 (50%), Gaps = 4/95 (4%) Frame = -1 Query: 310 ECLCGRTAVLRTV--KTSTNRGRKFWGCERYNK--NGSCDFFHWDDNEEYAKFRETYDAK 143 +C CG VLRT+ +T+ N G KFWGC + + C+ F W DNE+ + D + Sbjct: 38 KCSCGEFLVLRTITDETNPNYGEKFWGCRNWRNRIDNGCNHFQWVDNED-----DVVDER 92 Query: 142 KEEFEKLYKNVDALKQIKKVFKADIVELKRDIKVL 38 + K K + LKQ K +++ ++ K++ Sbjct: 93 DVKIAKQKKKIGKLKQSVCFLKEELMNSRKSCKIV 127