BLASTX nr result
ID: Scutellaria24_contig00014748
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00014748 (489 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003616146.1| hypothetical protein MTR_5g076600 [Medicago ... 82 3e-14 ref|XP_003578613.1| PREDICTED: uncharacterized protein LOC100833... 75 6e-12 tpg|DAA40722.1| TPA: hypothetical protein ZEAMMB73_194935 [Zea m... 73 3e-11 dbj|BAK05462.1| predicted protein [Hordeum vulgare subsp. vulgare] 70 1e-10 ref|XP_003573896.1| PREDICTED: uncharacterized protein LOC100840... 67 2e-09 >ref|XP_003616146.1| hypothetical protein MTR_5g076600 [Medicago truncatula] gi|355517481|gb|AES99104.1| hypothetical protein MTR_5g076600 [Medicago truncatula] Length = 119 Score = 82.4 bits (202), Expect = 3e-14 Identities = 39/55 (70%), Positives = 47/55 (85%) Frame = -2 Query: 410 MRIFGKKVHARQVIVVASGVLLLATTTYDVHRSIKNNDTPPSPQQLQALQHYIDS 246 MRIFGK V RQ+I+ ASG+L LA+TTYDVHRSIKNN+TPPS +QL+AL+ YI S Sbjct: 1 MRIFGKPVFPRQIILFASGLLFLASTTYDVHRSIKNNETPPSEEQLKALEEYIKS 55 >ref|XP_003578613.1| PREDICTED: uncharacterized protein LOC100833743 [Brachypodium distachyon] Length = 58 Score = 75.1 bits (183), Expect = 6e-12 Identities = 34/55 (61%), Positives = 43/55 (78%) Frame = -2 Query: 410 MRIFGKKVHARQVIVVASGVLLLATTTYDVHRSIKNNDTPPSPQQLQALQHYIDS 246 MR+ GK V ARQV + A+G++ TTYDVHRSIKNND PP+ +Q++ALQ YIDS Sbjct: 1 MRLLGKHVSARQVALFAAGLVFFGATTYDVHRSIKNNDQPPTREQMEALQQYIDS 55 >tpg|DAA40722.1| TPA: hypothetical protein ZEAMMB73_194935 [Zea mays] Length = 750 Score = 72.8 bits (177), Expect = 3e-11 Identities = 31/55 (56%), Positives = 44/55 (80%) Frame = -2 Query: 410 MRIFGKKVHARQVIVVASGVLLLATTTYDVHRSIKNNDTPPSPQQLQALQHYIDS 246 MR+FGK V RQ+++ A+G++ TTYDVHRSIKNN+ PP+ +Q++ALQ YI+S Sbjct: 687 MRLFGKHVFPRQIVLFAAGMVFFGATTYDVHRSIKNNEQPPTREQMEALQDYINS 741 >dbj|BAK05462.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 58 Score = 70.5 bits (171), Expect = 1e-10 Identities = 30/55 (54%), Positives = 43/55 (78%) Frame = -2 Query: 410 MRIFGKKVHARQVIVVASGVLLLATTTYDVHRSIKNNDTPPSPQQLQALQHYIDS 246 MR+ G+ V RQ++++A+G++ TTYDVHRSIKNND PP+ +Q+ ALQ +IDS Sbjct: 1 MRLLGRHVSPRQIVLLAAGLVFFGATTYDVHRSIKNNDQPPTSEQVAALQAFIDS 55 >ref|XP_003573896.1| PREDICTED: uncharacterized protein LOC100840032 [Brachypodium distachyon] Length = 58 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/55 (58%), Positives = 40/55 (72%) Frame = -2 Query: 410 MRIFGKKVHARQVIVVASGVLLLATTTYDVHRSIKNNDTPPSPQQLQALQHYIDS 246 MR K V RQV + A+G++L TTYDVHRSIKNND P + +Q++ALQ YIDS Sbjct: 1 MRPLDKHVSPRQVALFAAGLMLFGETTYDVHRSIKNNDQPSTREQMEALQEYIDS 55