BLASTX nr result
ID: Scutellaria24_contig00014722
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00014722 (258 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285215.2| PREDICTED: ethylene-responsive transcription... 60 1e-07 ref|XP_003588762.1| Ethylene-responsive transcription factor SHI... 59 3e-07 gb|AEW22949.1| putative DREB protein [Rosa chinensis] 59 4e-07 ref|XP_002309625.1| AP2/ERF domain-containing transcription fact... 59 4e-07 ref|XP_002324859.1| AP2/ERF domain-containing transcription fact... 59 4e-07 >ref|XP_002285215.2| PREDICTED: ethylene-responsive transcription factor WIN1-like [Vitis vinifera] gi|297738957|emb|CBI28202.3| unnamed protein product [Vitis vinifera] Length = 239 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/47 (65%), Positives = 35/47 (74%) Frame = +1 Query: 118 SGIKLCSIKQSTSISEHNTNMVQSNKFRGVRQRQWGSWVSEIRHPLL 258 S L S+ Q ++S +NMVQS KFRGVRQR WGSWVSEIRHPLL Sbjct: 17 SRTSLSSVVQ-INLSFSPSNMVQSKKFRGVRQRHWGSWVSEIRHPLL 62 >ref|XP_003588762.1| Ethylene-responsive transcription factor SHINE [Medicago truncatula] gi|355477810|gb|AES59013.1| Ethylene-responsive transcription factor SHINE [Medicago truncatula] Length = 197 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +1 Query: 178 MVQSNKFRGVRQRQWGSWVSEIRHPLL 258 MVQ NKFRGVRQRQWGSWVSEIRHPLL Sbjct: 1 MVQRNKFRGVRQRQWGSWVSEIRHPLL 27 >gb|AEW22949.1| putative DREB protein [Rosa chinensis] Length = 96 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +1 Query: 178 MVQSNKFRGVRQRQWGSWVSEIRHPLL 258 MVQS KFRGVRQRQWGSWVSEIRHPLL Sbjct: 1 MVQSRKFRGVRQRQWGSWVSEIRHPLL 27 >ref|XP_002309625.1| AP2/ERF domain-containing transcription factor [Populus trichocarpa] gi|222855601|gb|EEE93148.1| AP2/ERF domain-containing transcription factor [Populus trichocarpa] Length = 192 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +1 Query: 178 MVQSNKFRGVRQRQWGSWVSEIRHPLL 258 MVQS KFRGVRQRQWGSWVSEIRHPLL Sbjct: 1 MVQSKKFRGVRQRQWGSWVSEIRHPLL 27 >ref|XP_002324859.1| AP2/ERF domain-containing transcription factor [Populus trichocarpa] gi|118486668|gb|ABK95171.1| unknown [Populus trichocarpa] gi|222866293|gb|EEF03424.1| AP2/ERF domain-containing transcription factor [Populus trichocarpa] Length = 178 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +1 Query: 178 MVQSNKFRGVRQRQWGSWVSEIRHPLL 258 MVQS KFRGVRQRQWGSWVSEIRHPLL Sbjct: 1 MVQSKKFRGVRQRQWGSWVSEIRHPLL 27