BLASTX nr result
ID: Scutellaria24_contig00014705
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00014705 (455 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004149521.1| PREDICTED: tetratricopeptide repeat protein ... 183 1e-44 ref|XP_002514581.1| o-linked n-acetylglucosamine transferase, og... 181 4e-44 ref|XP_002881885.1| hypothetical protein ARALYDRAFT_483406 [Arab... 176 2e-42 ref|NP_850382.1| tetratricopeptide repeat-containing protein [Ar... 176 2e-42 ref|XP_003548710.1| PREDICTED: tetratricopeptide repeat protein ... 174 9e-42 >ref|XP_004149521.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Cucumis sativus] gi|449517393|ref|XP_004165730.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Cucumis sativus] Length = 708 Score = 183 bits (464), Expect = 1e-44 Identities = 88/121 (72%), Positives = 108/121 (89%) Frame = +1 Query: 88 NSDLTFELGIQYAEHRNLDAALQYAKQYLDATGGSMMKGWRLLALILSAQQRFSEAEVVT 267 N DL ELG+QY+E+RNL+AALQYAK+++D TGGS++KGW+LLAL+LSAQ+RFSEAEVVT Sbjct: 436 NLDLMLELGVQYSEYRNLNAALQYAKKFIDETGGSVLKGWQLLALVLSAQKRFSEAEVVT 495 Query: 268 GAALDETSKWDHGPLLRMKAKLKISQSLHKDAIEAYRNLLALVQAQRKTCGPLVSAPQVD 447 AA+DET+KW+ GPLLR+KAKLK+SQSLH DAIE YR LLALVQAQ+K+ GPL PQV+ Sbjct: 496 DAAMDETTKWEQGPLLRLKAKLKVSQSLHMDAIETYRYLLALVQAQKKSFGPLRIVPQVE 555 Query: 448 D 450 D Sbjct: 556 D 556 >ref|XP_002514581.1| o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis] gi|223546185|gb|EEF47687.1| o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis] Length = 701 Score = 181 bits (460), Expect = 4e-44 Identities = 89/121 (73%), Positives = 107/121 (88%) Frame = +1 Query: 88 NSDLTFELGIQYAEHRNLDAALQYAKQYLDATGGSMMKGWRLLALILSAQQRFSEAEVVT 267 N DL F+LG+QYAE RNL+AAL++AKQ++DATGGS++KGWRLLAL+LSAQQRF EAEVVT Sbjct: 429 NPDLVFDLGVQYAEQRNLNAALRFAKQFIDATGGSILKGWRLLALVLSAQQRFPEAEVVT 488 Query: 268 GAALDETSKWDHGPLLRMKAKLKISQSLHKDAIEAYRNLLALVQAQRKTCGPLVSAPQVD 447 AALDET+KW+ GPLLR+KAKLKISQSL DA+E YR LLALVQA+RK+ GPL S+ Q + Sbjct: 489 DAALDETAKWEQGPLLRLKAKLKISQSLPMDAVETYRYLLALVQARRKSFGPLRSSSQAE 548 Query: 448 D 450 D Sbjct: 549 D 549 >ref|XP_002881885.1| hypothetical protein ARALYDRAFT_483406 [Arabidopsis lyrata subsp. lyrata] gi|297327724|gb|EFH58144.1| hypothetical protein ARALYDRAFT_483406 [Arabidopsis lyrata subsp. lyrata] Length = 704 Score = 176 bits (445), Expect = 2e-42 Identities = 87/121 (71%), Positives = 104/121 (85%) Frame = +1 Query: 88 NSDLTFELGIQYAEHRNLDAALQYAKQYLDATGGSMMKGWRLLALILSAQQRFSEAEVVT 267 N DL FELG+QYAE RNL AA +YAK+++DATGGS++KGWR LAL+LSAQQRFSEAEVVT Sbjct: 429 NPDLIFELGVQYAEQRNLKAASRYAKEFIDATGGSVLKGWRFLALVLSAQQRFSEAEVVT 488 Query: 268 GAALDETSKWDHGPLLRMKAKLKISQSLHKDAIEAYRNLLALVQAQRKTCGPLVSAPQVD 447 AALDET+KWD GPLLR+KAKLKISQS +A+E YR LLALVQAQRK+ GPL + Q++ Sbjct: 489 DAALDETAKWDQGPLLRLKAKLKISQSNPTEAVETYRYLLALVQAQRKSFGPLRTLSQME 548 Query: 448 D 450 + Sbjct: 549 E 549 >ref|NP_850382.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] gi|27450574|gb|AAO14644.1|AF474176_1 pollen-specific calmodulin-binding protein [Arabidopsis thaliana] gi|209529807|gb|ACI49798.1| At2g43040 [Arabidopsis thaliana] gi|330255108|gb|AEC10202.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 704 Score = 176 bits (445), Expect = 2e-42 Identities = 87/121 (71%), Positives = 104/121 (85%) Frame = +1 Query: 88 NSDLTFELGIQYAEHRNLDAALQYAKQYLDATGGSMMKGWRLLALILSAQQRFSEAEVVT 267 N DL FELG+QYAE RNL AA +YAK+++DATGGS++KGWR LAL+LSAQQRFSEAEVVT Sbjct: 429 NPDLIFELGVQYAEQRNLKAASRYAKEFIDATGGSVLKGWRFLALVLSAQQRFSEAEVVT 488 Query: 268 GAALDETSKWDHGPLLRMKAKLKISQSLHKDAIEAYRNLLALVQAQRKTCGPLVSAPQVD 447 AALDET+KWD GPLLR+KAKLKISQS +A+E YR LLALVQAQRK+ GPL + Q++ Sbjct: 489 DAALDETAKWDQGPLLRLKAKLKISQSNPTEAVETYRYLLALVQAQRKSFGPLRTLSQME 548 Query: 448 D 450 + Sbjct: 549 E 549 >ref|XP_003548710.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Glycine max] Length = 694 Score = 174 bits (440), Expect = 9e-42 Identities = 90/121 (74%), Positives = 100/121 (82%) Frame = +1 Query: 88 NSDLTFELGIQYAEHRNLDAALQYAKQYLDATGGSMMKGWRLLALILSAQQRFSEAEVVT 267 N DL FEL IQYAEHRNL AAL AKQ+ D TGGS +KGWRLLAL+LSAQ+RFSEAEVVT Sbjct: 422 NYDLIFELAIQYAEHRNLTAALSCAKQFFDKTGGSKLKGWRLLALVLSAQKRFSEAEVVT 481 Query: 268 GAALDETSKWDHGPLLRMKAKLKISQSLHKDAIEAYRNLLALVQAQRKTCGPLVSAPQVD 447 AALDET+KW+ GPLLR+KAKLKISQ DAIE YR LLALVQAQRK+ GPL + QV+ Sbjct: 482 DAALDETAKWEQGPLLRLKAKLKISQLRPMDAIEIYRYLLALVQAQRKSSGPLKLSSQVE 541 Query: 448 D 450 D Sbjct: 542 D 542