BLASTX nr result
ID: Scutellaria24_contig00014666
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00014666 (497 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514759.1| conserved hypothetical protein [Ricinus comm... 68 7e-10 >ref|XP_002514759.1| conserved hypothetical protein [Ricinus communis] gi|223546363|gb|EEF47865.1| conserved hypothetical protein [Ricinus communis] Length = 126 Score = 68.2 bits (165), Expect = 7e-10 Identities = 37/85 (43%), Positives = 51/85 (60%), Gaps = 10/85 (11%) Frame = -3 Query: 495 LIVFCTGFLSIN---VSCLRSVDLALRR-------VRSSRMLKADSWQDMNVPLDIAPSP 346 L++ C G+LS VS L S+DLALR ++SRML + D+ AP+P Sbjct: 42 LLLLCIGYLSFQPEKVSSLTSIDLALRLKQELLPVAQNSRMLTTVALDDLQTFTSSAPAP 101 Query: 345 ATTLDPDESQKRRVRRGSDPIHNKC 271 + DP++S KR VR+GSDPIHN+C Sbjct: 102 SMVFDPNQSNKRTVRKGSDPIHNRC 126