BLASTX nr result
ID: Scutellaria24_contig00014552
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00014552 (504 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_793071.1| PREDICTED: protein SPEC3-like [Strongylocentrot... 60 2e-07 gb|EFW41117.1| FYVE-type Zn finger-containing protein [Capsaspor... 55 6e-06 >ref|XP_793071.1| PREDICTED: protein SPEC3-like [Strongylocentrotus purpuratus] Length = 253 Score = 59.7 bits (143), Expect = 2e-07 Identities = 24/38 (63%), Positives = 26/38 (68%) Frame = -3 Query: 502 YAPPPQQNYRPVQQQGYTPQPHQSYESPPQQGYVPRMQ 389 YAPPPQQ Y P QQGY P P Q + PPQQGY P +Q Sbjct: 171 YAPPPQQGYAPPPQQGYAPPPQQGFAPPPQQGYAPPLQ 208 >gb|EFW41117.1| FYVE-type Zn finger-containing protein [Capsaspora owczarzaki ATCC 30864] Length = 620 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/40 (62%), Positives = 27/40 (67%) Frame = -3 Query: 502 YAPPPQQNYRPVQQQGYTPQPHQSYESPPQQGYVPRMQRG 383 Y P QQ Y P QQQGY PQP Q Y PPQQGY P+ Q+G Sbjct: 497 YPPQQQQGYPPQQQQGYPPQPQQGY--PPQQGYPPQQQQG 534