BLASTX nr result
ID: Scutellaria24_contig00014138
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00014138 (269 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC84405.2| 17.67 kDa heat-shock protein [Helianthus annuus] 61 8e-08 emb|CAC84406.1| 17.6 kDa heat-shock protein [Helianthus annuus] 61 8e-08 gb|ABW89467.1| low molecular weight heat shock protein [Gossypiu... 61 1e-07 emb|CAB55634.2| 17.9 kDa heat-shock protein [Helianthus annuus] 60 2e-07 sp|P27396.1|HSP11_DAUCA RecName: Full=17.8 kDa class I heat shoc... 60 2e-07 >emb|CAC84405.2| 17.67 kDa heat-shock protein [Helianthus annuus] Length = 155 Score = 61.2 bits (147), Expect = 8e-08 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +1 Query: 151 MSMIPSVFGRRGSSIFDPFALEVWDPFRDFPISSEA 258 MS++PS+FG R SSIFDPF+L VWDPFRDFPIS+ + Sbjct: 1 MSIVPSLFGSRRSSIFDPFSLYVWDPFRDFPISTSS 36 >emb|CAC84406.1| 17.6 kDa heat-shock protein [Helianthus annuus] Length = 155 Score = 61.2 bits (147), Expect = 8e-08 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +1 Query: 151 MSMIPSVFGRRGSSIFDPFALEVWDPFRDFPISSEA 258 MS+IPS+F R SS+FDPF+L+VWDPFRDFPISS + Sbjct: 1 MSIIPSLFAGRRSSVFDPFSLDVWDPFRDFPISSSS 36 >gb|ABW89467.1| low molecular weight heat shock protein [Gossypium hirsutum] Length = 158 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +1 Query: 151 MSMIPSVFGRRGSSIFDPFALEVWDPFRDFPISSEAS 261 MS+IPS FG R SS FDPF+L+VWDPF+DFP SS +S Sbjct: 1 MSLIPSFFGNRRSSAFDPFSLDVWDPFKDFPFSSPSS 37 >emb|CAB55634.2| 17.9 kDa heat-shock protein [Helianthus annuus] Length = 157 Score = 60.1 bits (144), Expect = 2e-07 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +1 Query: 151 MSMIPSVFGRRGSSIFDPFALEVWDPFRDFPISSEA 258 MS++ S+FG R SS+FDPF+L+VWDPFRDFPISS + Sbjct: 1 MSIVSSLFGGRRSSVFDPFSLDVWDPFRDFPISSSS 36 >sp|P27396.1|HSP11_DAUCA RecName: Full=17.8 kDa class I heat shock protein; AltName: Full=Clone DCHSP17.7 gi|18353|emb|CAA37847.1| heat shock protein [Daucus carota] Length = 157 Score = 60.1 bits (144), Expect = 2e-07 Identities = 26/40 (65%), Positives = 35/40 (87%), Gaps = 1/40 (2%) Frame = +1 Query: 151 MSMIPSVFGRRGSSIFDPFALEVWDPFRDFP-ISSEASQF 267 MS+IPS FG R S++FDPF+L+VWDPF+DFP ++S AS+F Sbjct: 1 MSIIPSFFGGRRSNVFDPFSLDVWDPFKDFPLVTSSASEF 40