BLASTX nr result
ID: Scutellaria24_contig00013713
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00013713 (241 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF96582.1| lignan glucosyltransferase [Sesamum indicum] 60 2e-07 dbj|BAF96581.1| lignan glucosyltransferase [Sesamum alatum] 60 2e-07 dbj|BAF96583.1| lignan glucosyltransferase [Sesamum radiatum] 59 3e-07 >dbj|BAF96582.1| lignan glucosyltransferase [Sesamum indicum] Length = 476 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/47 (57%), Positives = 38/47 (80%) Frame = -2 Query: 240 AVRELMDPDNKIRVKVKELQGKSKKALDEGQSSYNFLATLIHNVIDN 100 A+R+LMDP+N+IRVKV+ L+ KS+ AL EG SSYN+L + NV++N Sbjct: 428 AIRQLMDPENEIRVKVRALKEKSRMALMEGGSSYNYLKRFVENVVNN 474 >dbj|BAF96581.1| lignan glucosyltransferase [Sesamum alatum] Length = 476 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/47 (57%), Positives = 38/47 (80%) Frame = -2 Query: 240 AVRELMDPDNKIRVKVKELQGKSKKALDEGQSSYNFLATLIHNVIDN 100 A+R+LMDP+N+IRVKV+ L+ KS+ AL EG SSYN+L + NV++N Sbjct: 428 AIRQLMDPENEIRVKVRALKEKSRMALMEGGSSYNYLKRFVENVVNN 474 >dbj|BAF96583.1| lignan glucosyltransferase [Sesamum radiatum] Length = 475 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/47 (57%), Positives = 37/47 (78%) Frame = -2 Query: 240 AVRELMDPDNKIRVKVKELQGKSKKALDEGQSSYNFLATLIHNVIDN 100 A+R+LMDP+N+IRVKV+ L KS+ AL EG SSYN+L + NV++N Sbjct: 427 AIRQLMDPENEIRVKVRALTEKSRMALMEGGSSYNYLKRFVENVVNN 473