BLASTX nr result
ID: Scutellaria24_contig00013635
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00013635 (259 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEE60890.1| citrate synthase [Paeonia suffruticosa] 81 1e-13 sp|O80433.1|CISY_DAUCA RecName: Full=Citrate synthase, mitochond... 79 5e-13 emb|CAA59008.1| citrate synthase [Nicotiana tabacum] 77 1e-12 gb|AFI08590.1| citrate synthase [Rhododendron micranthum] 77 1e-12 gb|AFL48183.1| citrate synthase [Capsicum annuum] 76 3e-12 >gb|AEE60890.1| citrate synthase [Paeonia suffruticosa] Length = 471 Score = 80.9 bits (198), Expect = 1e-13 Identities = 40/51 (78%), Positives = 43/51 (84%) Frame = +1 Query: 106 MVFHRSVGLLSKLRSRAVQQPGLRNSVRWFQVQTSSDVDLHSQLKELIPEQ 258 MVF RS+ LLSKLRSR QQ L +SVRWFQVQ SSD+DLHSQLKELIPEQ Sbjct: 1 MVFFRSLSLLSKLRSRGAQQSSLNSSVRWFQVQASSDLDLHSQLKELIPEQ 51 >sp|O80433.1|CISY_DAUCA RecName: Full=Citrate synthase, mitochondrial; Flags: Precursor gi|3493367|dbj|BAA32557.1| citrate synthase [Daucus carota] Length = 472 Score = 78.6 bits (192), Expect = 5e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 1/52 (1%) Frame = +1 Query: 106 MVFHRSVGLLSKLRSRAVQQPGLRNSVRWFQVQTS-SDVDLHSQLKELIPEQ 258 MVF RSV LL+KLRSRAVQQ L N+VRWFQVQTS SD+DL SQLKELIPEQ Sbjct: 1 MVFFRSVSLLNKLRSRAVQQSNLSNTVRWFQVQTSASDLDLRSQLKELIPEQ 52 >emb|CAA59008.1| citrate synthase [Nicotiana tabacum] Length = 469 Score = 77.4 bits (189), Expect = 1e-12 Identities = 39/51 (76%), Positives = 43/51 (84%) Frame = +1 Query: 106 MVFHRSVGLLSKLRSRAVQQPGLRNSVRWFQVQTSSDVDLHSQLKELIPEQ 258 MVF+R V LLSKLRSRAVQQ L NSVRW QVQTSS +DL S+L+ELIPEQ Sbjct: 1 MVFYRGVSLLSKLRSRAVQQTNLSNSVRWLQVQTSSGLDLRSELQELIPEQ 51 >gb|AFI08590.1| citrate synthase [Rhododendron micranthum] Length = 471 Score = 77.0 bits (188), Expect = 1e-12 Identities = 37/51 (72%), Positives = 43/51 (84%) Frame = +1 Query: 106 MVFHRSVGLLSKLRSRAVQQPGLRNSVRWFQVQTSSDVDLHSQLKELIPEQ 258 MVF R V LSKLRSR VQQP L ++VRW Q++TSSD+DLHSQLKELIPE+ Sbjct: 1 MVFFRVVSALSKLRSRLVQQPSLTSTVRWLQIETSSDLDLHSQLKELIPER 51 >gb|AFL48183.1| citrate synthase [Capsicum annuum] Length = 470 Score = 76.3 bits (186), Expect = 3e-12 Identities = 38/51 (74%), Positives = 44/51 (86%) Frame = +1 Query: 106 MVFHRSVGLLSKLRSRAVQQPGLRNSVRWFQVQTSSDVDLHSQLKELIPEQ 258 MVF+RSV LLSKLRSRAVQQ + NSVRW QVQ+SS +DL S+L+ELIPEQ Sbjct: 1 MVFYRSVSLLSKLRSRAVQQSNVSNSVRWLQVQSSSGLDLRSELQELIPEQ 51