BLASTX nr result
ID: Scutellaria24_contig00013448
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00013448 (254 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519375.1| NAC domain-containing protein, putative [Ric... 64 2e-08 gb|EEE63754.1| hypothetical protein OsJ_18573 [Oryza sativa Japo... 61 8e-08 gb|EAY98075.1| hypothetical protein OsI_19993 [Oryza sativa Indi... 61 8e-08 ref|NP_001055568.1| Os05g0418800 [Oryza sativa Japonica Group] g... 61 8e-08 gb|AAV25641.1| putative no apical meristem (NAM) protein [Oryza ... 61 8e-08 >ref|XP_002519375.1| NAC domain-containing protein, putative [Ricinus communis] gi|223541442|gb|EEF42992.1| NAC domain-containing protein, putative [Ricinus communis] Length = 421 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/46 (58%), Positives = 34/46 (73%) Frame = -1 Query: 140 ASMNNQDQHHQENMAAMSKQDEHENDVVMPGFRFHPTEEELIEFYL 3 +S + +HH AA D+HE+D+VMPGFRFHPTEEEL+EFYL Sbjct: 18 SSNTSARKHHHHAAAAADDDDDHEHDMVMPGFRFHPTEEELVEFYL 63 >gb|EEE63754.1| hypothetical protein OsJ_18573 [Oryza sativa Japonica Group] Length = 236 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 110 QENMAAMSKQDEHENDVVMPGFRFHPTEEELIEFYL 3 QE AA D HEND+VMPGFRFHPTEEELIEFYL Sbjct: 24 QEEAAAAVAGDSHENDLVMPGFRFHPTEEELIEFYL 59 >gb|EAY98075.1| hypothetical protein OsI_19993 [Oryza sativa Indica Group] Length = 414 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 110 QENMAAMSKQDEHENDVVMPGFRFHPTEEELIEFYL 3 QE AA D HEND+VMPGFRFHPTEEELIEFYL Sbjct: 21 QEEAAAAVAGDSHENDLVMPGFRFHPTEEELIEFYL 56 >ref|NP_001055568.1| Os05g0418800 [Oryza sativa Japonica Group] gi|113579119|dbj|BAF17482.1| Os05g0418800 [Oryza sativa Japonica Group] Length = 417 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 110 QENMAAMSKQDEHENDVVMPGFRFHPTEEELIEFYL 3 QE AA D HEND+VMPGFRFHPTEEELIEFYL Sbjct: 24 QEEAAAAVAGDSHENDLVMPGFRFHPTEEELIEFYL 59 >gb|AAV25641.1| putative no apical meristem (NAM) protein [Oryza sativa Japonica Group] Length = 476 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 110 QENMAAMSKQDEHENDVVMPGFRFHPTEEELIEFYL 3 QE AA D HEND+VMPGFRFHPTEEELIEFYL Sbjct: 83 QEEAAAAVAGDSHENDLVMPGFRFHPTEEELIEFYL 118