BLASTX nr result
ID: Scutellaria24_contig00013365
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00013365 (568 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002299101.1| predicted protein [Populus trichocarpa] gi|2... 80 2e-13 ref|XP_002525421.1| conserved hypothetical protein [Ricinus comm... 79 4e-13 ref|XP_002325840.1| predicted protein [Populus trichocarpa] gi|2... 79 4e-13 ref|XP_002281809.1| PREDICTED: uncharacterized protein LOC100255... 79 4e-13 ref|XP_002523424.1| conserved hypothetical protein [Ricinus comm... 79 5e-13 >ref|XP_002299101.1| predicted protein [Populus trichocarpa] gi|222846359|gb|EEE83906.1| predicted protein [Populus trichocarpa] Length = 199 Score = 80.1 bits (196), Expect = 2e-13 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = -2 Query: 567 LVSPGAWLTDLCQERYEVREKKTAKKKPRGLKGMGGVESDSE 442 LVSPGAWL+DLCQERYEVREKKT+KK+PRGLK MG +ESDSE Sbjct: 158 LVSPGAWLSDLCQERYEVREKKTSKKRPRGLKAMGSMESDSE 199 >ref|XP_002525421.1| conserved hypothetical protein [Ricinus communis] gi|223535234|gb|EEF36911.1| conserved hypothetical protein [Ricinus communis] Length = 222 Score = 79.3 bits (194), Expect = 4e-13 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = -2 Query: 567 LVSPGAWLTDLCQERYEVREKKTAKKKPRGLKGMGGVESDSE 442 LVSPGAWLTD+CQERYEVREKK++KK+PRGLK MG +ESDSE Sbjct: 181 LVSPGAWLTDMCQERYEVREKKSSKKRPRGLKAMGSMESDSE 222 >ref|XP_002325840.1| predicted protein [Populus trichocarpa] gi|222862715|gb|EEF00222.1| predicted protein [Populus trichocarpa] Length = 217 Score = 79.3 bits (194), Expect = 4e-13 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = -2 Query: 567 LVSPGAWLTDLCQERYEVREKKTAKKKPRGLKGMGGVESDSE 442 LVSPGAWLTD+CQERYEVREKK++KK+PRGLK MG +ESDSE Sbjct: 176 LVSPGAWLTDMCQERYEVREKKSSKKRPRGLKAMGSMESDSE 217 >ref|XP_002281809.1| PREDICTED: uncharacterized protein LOC100255634 [Vitis vinifera] gi|297739765|emb|CBI29947.3| unnamed protein product [Vitis vinifera] Length = 214 Score = 79.3 bits (194), Expect = 4e-13 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = -2 Query: 567 LVSPGAWLTDLCQERYEVREKKTAKKKPRGLKGMGGVESDSE 442 LVSPGAWL+D+CQERYEVREKKT+KK+PRGLK MG +ESDSE Sbjct: 173 LVSPGAWLSDMCQERYEVREKKTSKKRPRGLKAMGSMESDSE 214 >ref|XP_002523424.1| conserved hypothetical protein [Ricinus communis] gi|223537374|gb|EEF39003.1| conserved hypothetical protein [Ricinus communis] Length = 199 Score = 79.0 bits (193), Expect = 5e-13 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = -2 Query: 567 LVSPGAWLTDLCQERYEVREKKTAKKKPRGLKGMGGVESDSE 442 LVSPG+WLTDLCQERYEVREKK++KK+PRGLK MG +ESDSE Sbjct: 155 LVSPGSWLTDLCQERYEVREKKSSKKRPRGLKAMGSMESDSE 196