BLASTX nr result
ID: Scutellaria24_contig00013336
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00013336 (672 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002308886.1| predicted protein [Populus trichocarpa] gi|2... 65 2e-08 ref|XP_003554126.1| PREDICTED: uncharacterized protein LOC100808... 60 4e-07 ref|XP_002322621.1| predicted protein [Populus trichocarpa] gi|2... 57 4e-06 ref|XP_002522185.1| conserved hypothetical protein [Ricinus comm... 55 1e-05 >ref|XP_002308886.1| predicted protein [Populus trichocarpa] gi|222854862|gb|EEE92409.1| predicted protein [Populus trichocarpa] Length = 154 Score = 64.7 bits (156), Expect = 2e-08 Identities = 29/40 (72%), Positives = 38/40 (95%) Frame = -1 Query: 546 PLKVVYITNPIKFKATASEFRALVQELTGQDADMSELSRF 427 P+KVVYI+NP+KFKA+ASEFRALVQELTGQD+++ + S+F Sbjct: 30 PMKVVYISNPMKFKASASEFRALVQELTGQDSELPDPSKF 69 >ref|XP_003554126.1| PREDICTED: uncharacterized protein LOC100808231 [Glycine max] Length = 168 Score = 60.1 bits (144), Expect = 4e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -1 Query: 549 HPLKVVYITNPIKFKATASEFRALVQELTGQDAD 448 HP+KVVYI+NP+K K +ASEFRALVQELTGQDA+ Sbjct: 30 HPVKVVYISNPMKIKTSASEFRALVQELTGQDAE 63 >ref|XP_002322621.1| predicted protein [Populus trichocarpa] gi|222867251|gb|EEF04382.1| predicted protein [Populus trichocarpa] Length = 156 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = -1 Query: 546 PLKVVYITNPIKFKATASEFRALVQELTGQDADMSE 439 P+KVVYI+NP+KFK +AS FRALVQELTGQD+++ + Sbjct: 28 PMKVVYISNPMKFKISASGFRALVQELTGQDSELPD 63 >ref|XP_002522185.1| conserved hypothetical protein [Ricinus communis] gi|223538623|gb|EEF40226.1| conserved hypothetical protein [Ricinus communis] Length = 146 Score = 55.5 bits (132), Expect = 1e-05 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = -1 Query: 546 PLKVVYITNPIKFKATASEFRALVQELTGQDADM 445 P+KVVYI+NP+KFK +ASEFRALVQELTGQ +++ Sbjct: 19 PMKVVYISNPMKFKISASEFRALVQELTGQYSEL 52