BLASTX nr result
ID: Scutellaria24_contig00012988
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00012988 (379 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN61239.1| hypothetical protein VITISV_003190 [Vitis vinifera] 72 6e-11 >emb|CAN61239.1| hypothetical protein VITISV_003190 [Vitis vinifera] Length = 99 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/51 (64%), Positives = 41/51 (80%) Frame = +1 Query: 124 DKAAVLRRIRHRKSVNKVKAALKTLLSSPFASDDNFRVSQIRWADDAFAAP 276 DK VLRRIRHRK VNKV+ +TL+SSPF++ D+FRV + +W DDAFAAP Sbjct: 49 DKDLVLRRIRHRKRVNKVRNLFQTLVSSPFSTTDSFRVQEKKWVDDAFAAP 99