BLASTX nr result
ID: Scutellaria24_contig00012863
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00012863 (285 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_193324.1| condensin-2 complex subunit D3 [Arabidopsis tha... 57 1e-06 ref|XP_002870202.1| binding protein [Arabidopsis lyrata subsp. l... 57 2e-06 >ref|NP_193324.1| condensin-2 complex subunit D3 [Arabidopsis thaliana] gi|5281022|emb|CAB45995.1| hypothetical protein [Arabidopsis thaliana] gi|7268337|emb|CAB78631.1| hypothetical protein [Arabidopsis thaliana] gi|332658263|gb|AEE83663.1| condensin-2 complex subunit D3 [Arabidopsis thaliana] Length = 1314 Score = 57.4 bits (137), Expect = 1e-06 Identities = 32/57 (56%), Positives = 42/57 (73%), Gaps = 1/57 (1%) Frame = +3 Query: 78 RSVLRDVNNGGSTP-LSTMNVPKLKTRTAEVGKSAGRPSSEVISSVRRRQCFDSDDE 245 RSVLR+VN G +TP LS M+VPKL R++ +GRPS++V+ S+RRR F SDDE Sbjct: 1259 RSVLREVNGGAATPPLSAMSVPKL--RSSRGVSQSGRPSADVLESLRRRPTFMSDDE 1313 >ref|XP_002870202.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297316038|gb|EFH46461.1| binding protein [Arabidopsis lyrata subsp. lyrata] Length = 1315 Score = 56.6 bits (135), Expect = 2e-06 Identities = 32/57 (56%), Positives = 41/57 (71%), Gaps = 1/57 (1%) Frame = +3 Query: 78 RSVLRDVNNGGSTP-LSTMNVPKLKTRTAEVGKSAGRPSSEVISSVRRRQCFDSDDE 245 RSVLR+VN G +TP LS M+VPKL R + +GRPS++V+ S+RRR F SDDE Sbjct: 1260 RSVLREVNGGAATPPLSAMSVPKL--RLSRGVSQSGRPSADVLESLRRRPTFMSDDE 1314