BLASTX nr result
ID: Scutellaria24_contig00012853
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00012853 (752 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003532044.1| PREDICTED: transcription factor BPE-like [Gl... 124 2e-26 gb|AAQ14331.1|AF283506_1 MYC1 [Catharanthus roseus] 124 2e-26 ref|XP_002520177.1| DNA binding protein, putative [Ricinus commu... 117 3e-24 ref|XP_003517894.1| PREDICTED: transcription factor BPE-like [Gl... 116 4e-24 emb|CBI32056.3| unnamed protein product [Vitis vinifera] 115 8e-24 >ref|XP_003532044.1| PREDICTED: transcription factor BPE-like [Glycine max] Length = 273 Score = 124 bits (312), Expect = 2e-26 Identities = 67/90 (74%), Positives = 73/90 (81%), Gaps = 4/90 (4%) Frame = +2 Query: 422 SEGDNKRLKAVRSNGNRE---NKAEGEGNSGKAAEPPGK-AAELPKQDYIHVRARRGQAT 589 +EGD KR+K R+ G + NK EGE +SGK AE K A+E PKQDYIHVRARRGQAT Sbjct: 95 NEGDGKRVKGNRNEGGGDGGNNKGEGEVSSGKPAEQSAKPASEPPKQDYIHVRARRGQAT 154 Query: 590 DSHSLAERARREKISERMKILQDLVPGCNK 679 DSHSLAERARREKISERMKILQDLVPGCNK Sbjct: 155 DSHSLAERARREKISERMKILQDLVPGCNK 184 >gb|AAQ14331.1|AF283506_1 MYC1 [Catharanthus roseus] Length = 271 Score = 124 bits (311), Expect = 2e-26 Identities = 67/86 (77%), Positives = 70/86 (81%) Frame = +2 Query: 422 SEGDNKRLKAVRSNGNRENKAEGEGNSGKAAEPPGKAAELPKQDYIHVRARRGQATDSHS 601 +EGDNKRLK SN N E+KAEGE + K AEPP KQDYIHVRARRGQATDSHS Sbjct: 105 NEGDNKRLKTGGSNENHESKAEGE-ETAKPAEPP-------KQDYIHVRARRGQATDSHS 156 Query: 602 LAERARREKISERMKILQDLVPGCNK 679 LAERARREKISERMKILQDLVPGCNK Sbjct: 157 LAERARREKISERMKILQDLVPGCNK 182 >ref|XP_002520177.1| DNA binding protein, putative [Ricinus communis] gi|223540669|gb|EEF42232.1| DNA binding protein, putative [Ricinus communis] Length = 265 Score = 117 bits (292), Expect = 3e-24 Identities = 61/87 (70%), Positives = 70/87 (80%), Gaps = 1/87 (1%) Frame = +2 Query: 422 SEGDNKRLKAVRS-NGNRENKAEGEGNSGKAAEPPGKAAELPKQDYIHVRARRGQATDSH 598 ++ D KRLK + + N ++K+E E +SGK E + ELPKQDYIHVRARRGQATDSH Sbjct: 90 NDSDAKRLKTSGNLDENHDSKSEAEPSSGKHVEQNTQPPELPKQDYIHVRARRGQATDSH 149 Query: 599 SLAERARREKISERMKILQDLVPGCNK 679 SLAERARREKISERMKILQDLVPGCNK Sbjct: 150 SLAERARREKISERMKILQDLVPGCNK 176 >ref|XP_003517894.1| PREDICTED: transcription factor BPE-like [Glycine max] Length = 264 Score = 116 bits (291), Expect = 4e-24 Identities = 63/85 (74%), Positives = 67/85 (78%), Gaps = 1/85 (1%) Frame = +2 Query: 428 GDNKRLKAVRSNGNRENKAEGEGNSGKAAEPPGKA-AELPKQDYIHVRARRGQATDSHSL 604 GD KR+K S K EGE +SGK AE GK +E PKQDYIHVRARRGQATDSHSL Sbjct: 96 GDGKRVKTSESG-----KGEGETSSGKLAEQSGKPPSEPPKQDYIHVRARRGQATDSHSL 150 Query: 605 AERARREKISERMKILQDLVPGCNK 679 AERARREKISERMKILQD+VPGCNK Sbjct: 151 AERARREKISERMKILQDIVPGCNK 175 >emb|CBI32056.3| unnamed protein product [Vitis vinifera] Length = 208 Score = 115 bits (289), Expect = 8e-24 Identities = 61/84 (72%), Positives = 68/84 (80%), Gaps = 1/84 (1%) Frame = +2 Query: 431 DNKRLKAVRSNG-NRENKAEGEGNSGKAAEPPGKAAELPKQDYIHVRARRGQATDSHSLA 607 D KRLK S NR++K E E +SGK E ++A+ PKQD+IHVRARRGQATDSHSLA Sbjct: 37 DGKRLKTSGSRDENRDSKTEVETSSGKPVEQNPQSADPPKQDFIHVRARRGQATDSHSLA 96 Query: 608 ERARREKISERMKILQDLVPGCNK 679 ERARREKISERMKILQDLVPGCNK Sbjct: 97 ERARREKISERMKILQDLVPGCNK 120