BLASTX nr result
ID: Scutellaria24_contig00012605
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00012605 (274 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533208.1| heat shock protein 70 (HSP70)-interacting pr... 88 6e-16 ref|XP_002307091.1| predicted protein [Populus trichocarpa] gi|2... 88 6e-16 emb|CAN77716.1| hypothetical protein VITISV_023407 [Vitis vinifera] 88 6e-16 ref|XP_004143469.1| PREDICTED: uncharacterized protein LOC101209... 84 2e-14 ref|XP_003531355.1| PREDICTED: uncharacterized protein LOC100816... 83 3e-14 >ref|XP_002533208.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] gi|223526984|gb|EEF29179.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] Length = 627 Score = 88.2 bits (217), Expect = 6e-16 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -1 Query: 124 MDKGSPDCPYPGCFFCVMKEGNPSKRRSSLLKFFRELPSQD 2 MDK SPDCPYPGCFFCVMKEGNPSKRR+S+LKFFRELPSQD Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSKRRASILKFFRELPSQD 41 >ref|XP_002307091.1| predicted protein [Populus trichocarpa] gi|222856540|gb|EEE94087.1| predicted protein [Populus trichocarpa] Length = 618 Score = 88.2 bits (217), Expect = 6e-16 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -1 Query: 124 MDKGSPDCPYPGCFFCVMKEGNPSKRRSSLLKFFRELPSQD 2 MDK SPDCPYPGCFFCVMKEGNPSKRR+S+LKFFRELPSQD Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSKRRASILKFFRELPSQD 41 >emb|CAN77716.1| hypothetical protein VITISV_023407 [Vitis vinifera] Length = 635 Score = 88.2 bits (217), Expect = 6e-16 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -1 Query: 124 MDKGSPDCPYPGCFFCVMKEGNPSKRRSSLLKFFRELPSQD 2 MDK SPDCPYPGCFFCVMKEGNPSKRR+S+LKFFRELPSQD Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSKRRASILKFFRELPSQD 41 >ref|XP_004143469.1| PREDICTED: uncharacterized protein LOC101209622 [Cucumis sativus] gi|449532300|ref|XP_004173120.1| PREDICTED: uncharacterized LOC101209622 [Cucumis sativus] Length = 615 Score = 83.6 bits (205), Expect = 2e-14 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -1 Query: 124 MDKGSPDCPYPGCFFCVMKEGNPSKRRSSLLKFFRELPSQD 2 M+K S DCPYPGCFFCVMKEGNPSKRR+S+LKFFRELPSQD Sbjct: 1 MEKVSTDCPYPGCFFCVMKEGNPSKRRASILKFFRELPSQD 41 >ref|XP_003531355.1| PREDICTED: uncharacterized protein LOC100816695 [Glycine max] Length = 627 Score = 82.8 bits (203), Expect = 3e-14 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -1 Query: 124 MDKGSPDCPYPGCFFCVMKEGNPSKRRSSLLKFFRELPSQD 2 MDK S DCPYPGCFFCVMKEGNPSKRR+S+LKFFRELP QD Sbjct: 1 MDKVSSDCPYPGCFFCVMKEGNPSKRRASVLKFFRELPCQD 41