BLASTX nr result
ID: Scutellaria24_contig00012431
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00012431 (548 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004169455.1| PREDICTED: LOW QUALITY PROTEIN: ATP-citrate ... 91 2e-16 ref|XP_004148805.1| PREDICTED: ATP-citrate synthase beta chain p... 91 2e-16 ref|XP_004144209.1| PREDICTED: ATP-citrate synthase beta chain p... 91 2e-16 gb|AAK13318.1|AF290958_1 ATP:citrate lyase [Capsicum annuum] 91 2e-16 ref|NP_187317.1| ATP-citrate lyase B-1 [Arabidopsis thaliana] gi... 91 2e-16 >ref|XP_004169455.1| PREDICTED: LOW QUALITY PROTEIN: ATP-citrate synthase beta chain protein 1-like [Cucumis sativus] Length = 609 Score = 90.5 bits (223), Expect = 2e-16 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -1 Query: 548 GYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 426 GYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 569 GYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 609 >ref|XP_004148805.1| PREDICTED: ATP-citrate synthase beta chain protein 1-like [Cucumis sativus] Length = 608 Score = 90.5 bits (223), Expect = 2e-16 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -1 Query: 548 GYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 426 GYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 568 GYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >ref|XP_004144209.1| PREDICTED: ATP-citrate synthase beta chain protein 1-like [Cucumis sativus] gi|449530217|ref|XP_004172092.1| PREDICTED: ATP-citrate synthase beta chain protein 1-like [Cucumis sativus] Length = 608 Score = 90.5 bits (223), Expect = 2e-16 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -1 Query: 548 GYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 426 GYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 568 GYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >gb|AAK13318.1|AF290958_1 ATP:citrate lyase [Capsicum annuum] Length = 608 Score = 90.5 bits (223), Expect = 2e-16 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -1 Query: 548 GYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 426 GYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 568 GYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >ref|NP_187317.1| ATP-citrate lyase B-1 [Arabidopsis thaliana] gi|75268139|sp|Q9C522.1|ACLB1_ARATH RecName: Full=ATP-citrate synthase beta chain protein 1; Short=ATP-citrate synthase B-1; AltName: Full=ATP-citrate lyase B-1; AltName: Full=Citrate cleavage enzyme B-1 gi|12321918|gb|AAG50997.1|AC036106_10 ATP citrate lyase, putative; 38389-41775 [Arabidopsis thaliana] gi|12322674|gb|AAG51326.1|AC020580_6 ATP citrate lyase, putative; 3734-7120 [Arabidopsis thaliana] gi|27754223|gb|AAO22565.1| putative ATP citrate lyase [Arabidopsis thaliana] gi|332640905|gb|AEE74426.1| ATP-citrate lyase B-1 [Arabidopsis thaliana] Length = 608 Score = 90.5 bits (223), Expect = 2e-16 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -1 Query: 548 GYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 426 GYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 568 GYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608