BLASTX nr result
ID: Scutellaria24_contig00011667
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00011667 (235 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_195312.1| early-responsive to dehydration stress protein ... 63 2e-08 ref|XP_002869054.1| hypothetical protein ARALYDRAFT_491051 [Arab... 63 2e-08 ref|XP_003629245.1| Transmembrane protein 63C [Medicago truncatu... 62 6e-08 ref|XP_002534042.1| conserved hypothetical protein [Ricinus comm... 62 6e-08 ref|XP_004166972.1| PREDICTED: transmembrane protein 63B-like [C... 61 8e-08 >ref|NP_195312.1| early-responsive to dehydration stress protein (ERD4) [Arabidopsis thaliana] gi|3805853|emb|CAA21473.1| putative protein [Arabidopsis thaliana] gi|7270539|emb|CAB81496.1| putative protein [Arabidopsis thaliana] gi|19699093|gb|AAL90913.1| AT4g35870/F4B14_140 [Arabidopsis thaliana] gi|332661183|gb|AEE86583.1| early-responsive to dehydration stress protein (ERD4) [Arabidopsis thaliana] Length = 817 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -2 Query: 102 DAWYGNIQYLLNISAIGALTCLLIFIFVKLRSDH 1 DAWYGNIQYLLNIS IG L C+ IF+FVKLRSDH Sbjct: 36 DAWYGNIQYLLNISVIGLLCCVSIFLFVKLRSDH 69 >ref|XP_002869054.1| hypothetical protein ARALYDRAFT_491051 [Arabidopsis lyrata subsp. lyrata] gi|297314890|gb|EFH45313.1| hypothetical protein ARALYDRAFT_491051 [Arabidopsis lyrata subsp. lyrata] Length = 802 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -2 Query: 102 DAWYGNIQYLLNISAIGALTCLLIFIFVKLRSDH 1 DAWYGNIQYLLNIS IG L C+ IF+FVKLRSDH Sbjct: 21 DAWYGNIQYLLNISVIGLLCCVSIFLFVKLRSDH 54 >ref|XP_003629245.1| Transmembrane protein 63C [Medicago truncatula] gi|355523267|gb|AET03721.1| Transmembrane protein 63C [Medicago truncatula] Length = 887 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 96 WYGNIQYLLNISAIGALTCLLIFIFVKLRSDH 1 WYGNI YLLNISAIGAL CLLIF+ VKLRSDH Sbjct: 21 WYGNIDYLLNISAIGALFCLLIFLLVKLRSDH 52 >ref|XP_002534042.1| conserved hypothetical protein [Ricinus communis] gi|223525949|gb|EEF28346.1| conserved hypothetical protein [Ricinus communis] Length = 807 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -2 Query: 102 DAWYGNIQYLLNISAIGALTCLLIFIFVKLRSDH 1 ++WYGNIQYLLNIS IG L C+ IFIFVKLRSDH Sbjct: 24 NSWYGNIQYLLNISTIGLLFCIFIFIFVKLRSDH 57 >ref|XP_004166972.1| PREDICTED: transmembrane protein 63B-like [Cucumis sativus] Length = 809 Score = 61.2 bits (147), Expect = 8e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 99 AWYGNIQYLLNISAIGALTCLLIFIFVKLRSDH 1 +WYGNI+YLLNIS IGA +CL IF+FVKLRSDH Sbjct: 29 SWYGNIEYLLNISMIGAFSCLFIFLFVKLRSDH 61