BLASTX nr result
ID: Scutellaria24_contig00011506
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00011506 (617 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283629.2| PREDICTED: uncharacterized oxidoreductase yk... 52 3e-13 ref|XP_002458466.1| hypothetical protein SORBIDRAFT_03g034190 [S... 45 5e-10 ref|NP_001144514.1| hypothetical protein [Zea mays] gi|195643300... 45 1e-09 ref|XP_003530536.1| PREDICTED: uncharacterized oxidoreductase yk... 46 2e-09 ref|XP_004141022.1| PREDICTED: uncharacterized oxidoreductase Yk... 44 3e-09 >ref|XP_002283629.2| PREDICTED: uncharacterized oxidoreductase ykwC-like [Vitis vinifera] Length = 348 Score = 52.0 bits (123), Expect(2) = 3e-13 Identities = 22/37 (59%), Positives = 29/37 (78%) Frame = +3 Query: 84 AALSMFTGGDEALVTRLTTLLNHLGRIYYMGRPGKGQ 194 A L++F GGDE++V RL L +HLG++ YMG PGKGQ Sbjct: 179 ATLAIFAGGDESVVRRLNPLFSHLGKVNYMGGPGKGQ 215 Score = 48.1 bits (113), Expect(2) = 3e-13 Identities = 23/28 (82%), Positives = 24/28 (85%) Frame = +1 Query: 1 GALSGLHPSGVLIDMTTSDPSLTAEIHS 84 GALSGL P GVL+DMTTSDPSL AEI S Sbjct: 128 GALSGLRPGGVLVDMTTSDPSLAAEIAS 155 >ref|XP_002458466.1| hypothetical protein SORBIDRAFT_03g034190 [Sorghum bicolor] gi|241930441|gb|EES03586.1| hypothetical protein SORBIDRAFT_03g034190 [Sorghum bicolor] Length = 295 Score = 45.1 bits (105), Expect(2) = 5e-10 Identities = 20/26 (76%), Positives = 23/26 (88%) Frame = +1 Query: 1 GALSGLHPSGVLIDMTTSDPSLTAEI 78 GALSGL P G+L+DMTTSDP+L AEI Sbjct: 128 GALSGLAPGGILVDMTTSDPTLAAEI 153 Score = 44.3 bits (103), Expect(2) = 5e-10 Identities = 21/37 (56%), Positives = 24/37 (64%) Frame = +3 Query: 84 AALSMFTGGDEALVTRLTTLLNHLGRIYYMGRPGKGQ 194 AALS+F GGD A+V RL L +G YMG PG GQ Sbjct: 179 AALSIFAGGDAAVVARLAPLFKLMGNALYMGGPGAGQ 215 >ref|NP_001144514.1| hypothetical protein [Zea mays] gi|195643300|gb|ACG41118.1| hypothetical protein [Zea mays] gi|414880575|tpg|DAA57706.1| TPA: hypothetical protein ZEAMMB73_487540 [Zea mays] Length = 344 Score = 45.1 bits (105), Expect(2) = 1e-09 Identities = 20/26 (76%), Positives = 23/26 (88%) Frame = +1 Query: 1 GALSGLHPSGVLIDMTTSDPSLTAEI 78 GALSGL P G+L+DMTTSDP+L AEI Sbjct: 127 GALSGLTPGGILVDMTTSDPTLAAEI 152 Score = 42.7 bits (99), Expect(2) = 1e-09 Identities = 20/37 (54%), Positives = 23/37 (62%) Frame = +3 Query: 84 AALSMFTGGDEALVTRLTTLLNHLGRIYYMGRPGKGQ 194 A LS+F GGD A+V RL L +G YMG PG GQ Sbjct: 178 ATLSIFAGGDAAVVARLAPLFKLMGNALYMGGPGAGQ 214 >ref|XP_003530536.1| PREDICTED: uncharacterized oxidoreductase ykwC-like [Glycine max] Length = 309 Score = 45.8 bits (107), Expect(2) = 2e-09 Identities = 20/35 (57%), Positives = 26/35 (74%) Frame = +3 Query: 90 LSMFTGGDEALVTRLTTLLNHLGRIYYMGRPGKGQ 194 L++F GG+EA V RL L +HLG++ YMG GKGQ Sbjct: 145 LAIFAGGEEATVKRLEPLFSHLGKVKYMGGSGKGQ 179 Score = 42.0 bits (97), Expect(2) = 2e-09 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = +1 Query: 1 GALSGLHPSGVLIDMTTSDPSLTAEI 78 GALS L P GVL+DMTTS+PSL EI Sbjct: 92 GALSALRPGGVLVDMTTSEPSLATEI 117 >ref|XP_004141022.1| PREDICTED: uncharacterized oxidoreductase YkwC-like [Cucumis sativus] gi|449487969|ref|XP_004157891.1| PREDICTED: uncharacterized oxidoreductase YkwC-like [Cucumis sativus] Length = 310 Score = 43.9 bits (102), Expect(2) = 3e-09 Identities = 20/26 (76%), Positives = 23/26 (88%) Frame = +1 Query: 1 GALSGLHPSGVLIDMTTSDPSLTAEI 78 GAL+GL P GVLIDMTTS+PSL +EI Sbjct: 92 GALAGLRPGGVLIDMTTSEPSLASEI 117 Score = 43.1 bits (100), Expect(2) = 3e-09 Identities = 20/37 (54%), Positives = 26/37 (70%) Frame = +3 Query: 84 AALSMFTGGDEALVTRLTTLLNHLGRIYYMGRPGKGQ 194 A L++F GGDE V RL+ L + LG++ YMG GKGQ Sbjct: 143 ATLAIFAGGDEDEVQRLSPLFSLLGKVNYMGESGKGQ 179