BLASTX nr result
ID: Scutellaria24_contig00011468
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00011468 (693 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531393.1| Auxin-induced protein 5NG4, putative [Ricinu... 57 3e-06 >ref|XP_002531393.1| Auxin-induced protein 5NG4, putative [Ricinus communis] gi|223528986|gb|EEF30977.1| Auxin-induced protein 5NG4, putative [Ricinus communis] Length = 356 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = -1 Query: 693 SLVGSIIIVVGFYSVMWGKAKEVKVIEISMDGSSESISENTPLL 562 SL+G+IIIV GFY VMWGKAKE K + S GS ES S+N PLL Sbjct: 306 SLIGAIIIVTGFYWVMWGKAKEEKAGDDSAVGSCESSSDNVPLL 349