BLASTX nr result
ID: Scutellaria24_contig00011413
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00011413 (268 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI30071.3| unnamed protein product [Vitis vinifera] 69 5e-10 ref|XP_003632726.1| PREDICTED: protein GAST1-like [Vitis vinifer... 69 5e-10 ref|XP_002530088.1| GAST1 protein precursor, putative [Ricinus c... 65 4e-09 gb|AFK49188.1| unknown [Lotus japonicus] 64 2e-08 ref|XP_003554147.1| PREDICTED: protein GAST1-like isoform 2 [Gly... 60 2e-07 >emb|CBI30071.3| unnamed protein product [Vitis vinifera] Length = 106 Score = 68.6 bits (166), Expect = 5e-10 Identities = 32/47 (68%), Positives = 36/47 (76%), Gaps = 1/47 (2%) Frame = +2 Query: 131 VFLLLVQNHATSIYSPAPQPQPS-NSFPMYGATPGSLHPQECGPRCT 268 + LLLVQN+AT +P PQPQ S N FPM+G T GSLHPQEC PRCT Sbjct: 7 MLLLLVQNNATITEAPTPQPQQSTNGFPMHGVTQGSLHPQECAPRCT 53 >ref|XP_003632726.1| PREDICTED: protein GAST1-like [Vitis vinifera] gi|147845801|emb|CAN80098.1| hypothetical protein VITISV_028566 [Vitis vinifera] Length = 114 Score = 68.6 bits (166), Expect = 5e-10 Identities = 32/47 (68%), Positives = 36/47 (76%), Gaps = 1/47 (2%) Frame = +2 Query: 131 VFLLLVQNHATSIYSPAPQPQPS-NSFPMYGATPGSLHPQECGPRCT 268 + LLLVQN+AT +P PQPQ S N FPM+G T GSLHPQEC PRCT Sbjct: 15 MLLLLVQNNATITEAPTPQPQQSTNGFPMHGVTQGSLHPQECAPRCT 61 >ref|XP_002530088.1| GAST1 protein precursor, putative [Ricinus communis] gi|223530399|gb|EEF32287.1| GAST1 protein precursor, putative [Ricinus communis] Length = 116 Score = 65.5 bits (158), Expect = 4e-09 Identities = 29/62 (46%), Positives = 44/62 (70%), Gaps = 2/62 (3%) Frame = +2 Query: 89 MGRLKRDSIICFVFVFLLL--VQNHATSIYSPAPQPQPSNSFPMYGATPGSLHPQECGPR 262 M +++ S FV +LL +++HA++ +PAPQPQ ++S P YG+T GSL PQ+CGP+ Sbjct: 2 MMMMRKASFAMFVLALMLLFILESHASTSEAPAPQPQQNSSLPKYGSTQGSLQPQDCGPQ 61 Query: 263 CT 268 CT Sbjct: 62 CT 63 >gb|AFK49188.1| unknown [Lotus japonicus] Length = 118 Score = 63.5 bits (153), Expect = 2e-08 Identities = 31/56 (55%), Positives = 39/56 (69%), Gaps = 5/56 (8%) Frame = +2 Query: 113 IICFVFVFLLLVQNHATSIYSP--APQPQPSNS---FPMYGATPGSLHPQECGPRC 265 I+C V + LL V+NHA + +P AP PQP+N+ FP +G T GSL PQECGPRC Sbjct: 9 ILCLVQMLLLPVENHAEIVVTPIEAPSPQPANNTAQFPNHGITEGSLQPQECGPRC 64 >ref|XP_003554147.1| PREDICTED: protein GAST1-like isoform 2 [Glycine max] Length = 120 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/59 (49%), Positives = 40/59 (67%), Gaps = 7/59 (11%) Frame = +2 Query: 113 IICFVFVFLLLVQNHA----TSIYSPAPQPQPSNS---FPMYGATPGSLHPQECGPRCT 268 ++C V + LLLV+NHA +++ + APQP + + FP +G T GSL PQECGPRCT Sbjct: 9 VLCLVQMLLLLVENHAEIVVSTVEASAPQPHKNTTHTLFPNHGITEGSLKPQECGPRCT 67