BLASTX nr result
ID: Scutellaria24_contig00011296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00011296 (227 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001262898.1| hypothetical protein NFIA_115880 [Neosartory... 61 8e-08 >ref|XP_001262898.1| hypothetical protein NFIA_115880 [Neosartorya fischeri NRRL 181] gi|119411057|gb|EAW21001.1| hypothetical protein NFIA_115880 [Neosartorya fischeri NRRL 181] Length = 88 Score = 61.2 bits (147), Expect = 8e-08 Identities = 31/49 (63%), Positives = 35/49 (71%) Frame = -3 Query: 225 RSSVRVGRIAPRAISRPGGRYIPGVFNRPPEPMLAWI*RSSPARRPGEP 79 RSSV+ GRIA AI PGG YIPG F+RPP+P LA S+PAR P EP Sbjct: 25 RSSVQAGRIALPAIRCPGGHYIPGAFDRPPKPTLARPQGSTPARMPAEP 73