BLASTX nr result
ID: Scutellaria24_contig00010451
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00010451 (284 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67292.1| hypothetical protein VITISV_040598 [Vitis vinifera] 69 3e-10 emb|CBI25767.3| unnamed protein product [Vitis vinifera] 67 1e-09 ref|XP_002303367.1| predicted protein [Populus trichocarpa] gi|2... 67 2e-09 ref|XP_002532354.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 ref|XP_002868096.1| hypothetical protein ARALYDRAFT_329832 [Arab... 60 2e-07 >emb|CAN67292.1| hypothetical protein VITISV_040598 [Vitis vinifera] Length = 352 Score = 69.3 bits (168), Expect = 3e-10 Identities = 32/47 (68%), Positives = 38/47 (80%), Gaps = 5/47 (10%) Frame = -2 Query: 196 RKVLSEITNIQES-----SGKWLCPQKNKPDVGPPLKQLRLDQWFYR 71 RKVLSE TN+Q S +GKW CPQK+KPD+GPPLKQLRL+QW +R Sbjct: 305 RKVLSEKTNLQHSDVTEIAGKWKCPQKSKPDLGPPLKQLRLEQWVHR 351 >emb|CBI25767.3| unnamed protein product [Vitis vinifera] Length = 644 Score = 67.0 bits (162), Expect = 1e-09 Identities = 31/44 (70%), Positives = 36/44 (81%), Gaps = 5/44 (11%) Frame = -2 Query: 196 RKVLSEITNIQES-----SGKWLCPQKNKPDVGPPLKQLRLDQW 80 RKVLSE TN+Q S +GKW CPQK+KPD+GPPLKQLRL+QW Sbjct: 290 RKVLSEKTNLQHSDVTEIAGKWKCPQKSKPDLGPPLKQLRLEQW 333 >ref|XP_002303367.1| predicted protein [Populus trichocarpa] gi|222840799|gb|EEE78346.1| predicted protein [Populus trichocarpa] Length = 547 Score = 66.6 bits (161), Expect = 2e-09 Identities = 28/52 (53%), Positives = 41/52 (78%), Gaps = 5/52 (9%) Frame = -2 Query: 211 DAKIVRKVLSEITNIQES-----SGKWLCPQKNKPDVGPPLKQLRLDQWFYR 71 DA + RKVLSE++N++ +GKW CPQK+KP++GPP+KQLRL++W +R Sbjct: 495 DAAVKRKVLSEVSNLEHPDVIGVTGKWKCPQKSKPNLGPPMKQLRLERWVHR 546 >ref|XP_002532354.1| conserved hypothetical protein [Ricinus communis] gi|223527941|gb|EEF30027.1| conserved hypothetical protein [Ricinus communis] Length = 534 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 7/50 (14%) Frame = -2 Query: 196 RKVLSEITNIQ-------ESSGKWLCPQKNKPDVGPPLKQLRLDQWFYRA 68 RKVL E TN++ E +GKW CPQK+KP+ GPPLKQLRL++W +R+ Sbjct: 485 RKVLWERTNLEVEHIDAIEVTGKWRCPQKSKPNTGPPLKQLRLERWVHRS 534 >ref|XP_002868096.1| hypothetical protein ARALYDRAFT_329832 [Arabidopsis lyrata subsp. lyrata] gi|297313932|gb|EFH44355.1| hypothetical protein ARALYDRAFT_329832 [Arabidopsis lyrata subsp. lyrata] Length = 606 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/61 (45%), Positives = 40/61 (65%), Gaps = 5/61 (8%) Frame = -2 Query: 238 NLVEAKIKDDAKIVRKVLSEITNIQES-----SGKWLCPQKNKPDVGPPLKQLRLDQWFY 74 N+ + K++ RK+L E++N Q S +GKW CPQKNK ++ PPLKQLRLD W + Sbjct: 545 NIAGEEDKEERNKKRKILEEMSNHQSSGAEEMAGKWRCPQKNKRNIVPPLKQLRLDAWIH 604 Query: 73 R 71 + Sbjct: 605 K 605