BLASTX nr result
ID: Scutellaria24_contig00009606
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00009606 (235 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD96960.1| hypothetical protein [Cleome spinosa] 51 7e-09 ref|XP_002529115.1| uv excision repair protein rad23, putative [... 49 2e-08 gb|ACU18529.1| unknown [Glycine max] 45 3e-08 ref|XP_002282352.1| PREDICTED: putative DNA repair protein RAD23... 47 4e-08 ref|XP_002312393.1| predicted protein [Populus trichocarpa] gi|2... 49 5e-08 >gb|ABD96960.1| hypothetical protein [Cleome spinosa] Length = 435 Score = 50.8 bits (120), Expect(2) = 7e-09 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = +3 Query: 105 QLTPEEGEAIERLEAMGFD*ELVLEVFFARLQQQEREA 218 Q+TPEE EAIERLEAMGFD LVLEVFFA + +E A Sbjct: 386 QVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAA 423 Score = 33.9 bits (76), Expect(2) = 7e-09 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = +2 Query: 2 VNEPIEGREGINNMLGQLAGAAPQA 76 +NEP+EG EG N++ QLAG PQA Sbjct: 361 INEPVEGGEG-GNIINQLAGGVPQA 384 >ref|XP_002529115.1| uv excision repair protein rad23, putative [Ricinus communis] gi|223531394|gb|EEF33228.1| uv excision repair protein rad23, putative [Ricinus communis] Length = 409 Score = 48.5 bits (114), Expect(2) = 2e-08 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = +3 Query: 108 LTPEEGEAIERLEAMGFD*ELVLEVFFARLQQQEREA 218 +TPEE EAIERLEAMGFD LVLEVFFA + +E A Sbjct: 361 VTPEEREAIERLEAMGFDRGLVLEVFFACNKNEELAA 397 Score = 34.7 bits (78), Expect(2) = 2e-08 Identities = 16/25 (64%), Positives = 20/25 (80%) Frame = +2 Query: 2 VNEPIEGREGINNMLGQLAGAAPQA 76 +NEP+EG EG N++GQLA A PQA Sbjct: 336 INEPVEGGEG--NIMGQLAAAMPQA 358 >gb|ACU18529.1| unknown [Glycine max] Length = 382 Score = 44.7 bits (104), Expect(2) = 3e-08 Identities = 23/37 (62%), Positives = 28/37 (75%) Frame = +3 Query: 108 LTPEEGEAIERLEAMGFD*ELVLEVFFARLQQQEREA 218 +TPEE +AIERLEAMGFD VLEV+FA + +E A Sbjct: 334 VTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAA 370 Score = 37.7 bits (86), Expect(2) = 3e-08 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = +2 Query: 2 VNEPIEGREGINNMLGQLAGAAPQA 76 +NEP+EG EG N+LGQLAGA PQA Sbjct: 309 INEPVEGGEG--NILGQLAGAMPQA 331 >ref|XP_002282352.1| PREDICTED: putative DNA repair protein RAD23-3 [Vitis vinifera] gi|297737829|emb|CBI27030.3| unnamed protein product [Vitis vinifera] Length = 397 Score = 46.6 bits (109), Expect(2) = 4e-08 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = +3 Query: 108 LTPEEGEAIERLEAMGFD*ELVLEVFFARLQQQEREA 218 +TPEE EAI RLEAMGFD LVLEVFFA + +E A Sbjct: 349 VTPEEREAIARLEAMGFDRALVLEVFFACNKNEELAA 385 Score = 35.4 bits (80), Expect(2) = 4e-08 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = +2 Query: 2 VNEPIEGREGINNMLGQLAGAAPQA 76 +NEP+EG EG N+LGQLA A PQA Sbjct: 324 INEPVEGGEG--NILGQLAAAMPQA 346 >ref|XP_002312393.1| predicted protein [Populus trichocarpa] gi|222852213|gb|EEE89760.1| predicted protein [Populus trichocarpa] Length = 333 Score = 48.9 bits (115), Expect(2) = 5e-08 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = +3 Query: 108 LTPEEGEAIERLEAMGFD*ELVLEVFFARLQQQEREA 218 +TPEE EAIERLEAMGFD LVLEVFFA + +E A Sbjct: 287 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAA 323 Score = 33.1 bits (74), Expect(2) = 5e-08 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = +2 Query: 2 VNEPIEGREGINNMLGQLAGAAPQA 76 +NEP+E EG N+LGQLA A PQA Sbjct: 262 INEPVESGEG--NVLGQLAAAMPQA 284