BLASTX nr result
ID: Scutellaria24_contig00009224
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00009224 (435 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510290.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 ref|XP_002515368.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 ref|XP_003576206.1| PREDICTED: B3 domain-containing protein Os11... 60 2e-07 ref|XP_003567062.1| PREDICTED: B3 domain-containing protein Os01... 60 2e-07 ref|XP_002456269.1| hypothetical protein SORBIDRAFT_03g033260 [S... 60 2e-07 >ref|XP_002510290.1| conserved hypothetical protein [Ricinus communis] gi|223550991|gb|EEF52477.1| conserved hypothetical protein [Ricinus communis] Length = 285 Score = 60.1 bits (144), Expect = 2e-07 Identities = 33/106 (31%), Positives = 55/106 (51%), Gaps = 9/106 (8%) Frame = -1 Query: 321 QFFKVLLPGCFEK---------RLGLPPHFCIEARTEFVEEGVVTTCLGRWKMSMMEMEE 169 +FF+V++PG K + LP FC + + E + VV + W + + + + Sbjct: 6 RFFRVMMPGFRSKLVRGQYVSCKQPLPVAFCRQIKGEGSDRAVVKSSDREWHIKVGKCCD 65 Query: 168 IFYFHGCRWERFVKRHDLLVGNFIVFKHDSGMKFSASIFDKSCCEK 31 + WE FVK H L +G+F+VF+++ + F A +FD S CEK Sbjct: 66 GSLYFEEGWEDFVKHHGLNLGDFVVFEYNGDLVFDAIVFDSSACEK 111 >ref|XP_002515368.1| conserved hypothetical protein [Ricinus communis] gi|223545312|gb|EEF46817.1| conserved hypothetical protein [Ricinus communis] Length = 559 Score = 60.1 bits (144), Expect = 2e-07 Identities = 35/102 (34%), Positives = 54/102 (52%), Gaps = 3/102 (2%) Frame = -1 Query: 327 KMQFFKVLLPGCFEKRLGLPPHFCIEARTEFVEEGVVTTCLGR-W--KMSMMEMEEIFYF 157 K FFK LLPG FE +P F + + + V+++C G+ W K++ E+ Sbjct: 6 KPHFFKPLLPG-FEHEFLIPVSFFKYLKGQECKNAVLSSCPGKLWPIKINGRRFED---- 60 Query: 156 HGCRWERFVKRHDLLVGNFIVFKHDSGMKFSASIFDKSCCEK 31 W+ F + HDL VG+F+VF+H+ M F +FD S C + Sbjct: 61 ---GWKEFTRHHDLHVGDFLVFRHEGDMLFHVKVFDSSTCAR 99 >ref|XP_003576206.1| PREDICTED: B3 domain-containing protein Os11g0197600-like [Brachypodium distachyon] Length = 582 Score = 59.7 bits (143), Expect = 2e-07 Identities = 38/112 (33%), Positives = 59/112 (52%), Gaps = 4/112 (3%) Frame = -1 Query: 348 EGEGECVKMQFFKVLLPGCFEKRLGLPPHFCIEARTEFVEEGVVTTCLGRWKMSMMEM-- 175 EGE E QFF+V LP + +RL +P F R + G+V+ + + E+ Sbjct: 69 EGEEEKFGQQFFRVFLPQQYGERLRIPLSFNQYLRNQ--PAGMVSLKGQSGNIWLAELAV 126 Query: 174 --EEIFYFHGCRWERFVKRHDLLVGNFIVFKHDSGMKFSASIFDKSCCEKIS 25 E +F+ +G W+ FV+ H + G+F+ F++D KFS +FD C EK S Sbjct: 127 DTEGLFFANG--WKEFVRDHSIETGHFLTFRYDGRSKFSVVVFDGKCIEKPS 176 >ref|XP_003567062.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Brachypodium distachyon] Length = 381 Score = 59.7 bits (143), Expect = 2e-07 Identities = 38/110 (34%), Positives = 56/110 (50%), Gaps = 14/110 (12%) Frame = -1 Query: 318 FFKVLLPGCFEKRLGLPPHFCI----EARTEF------VEEGVVTTCLG----RWKMSMM 181 FFKVL+ G F+KRL +PP+FC EA T+ + T G W + + Sbjct: 19 FFKVLI-GDFQKRLKIPPNFCKHIPWEASTKAKKSLKEASSSMAATLEGPSGRTWPVVIR 77 Query: 180 EMEEIFYFHGCRWERFVKRHDLLVGNFIVFKHDSGMKFSASIFDKSCCEK 31 F W +FV+ L +F+VF+HD G +F+A +FDK+ CE+ Sbjct: 78 RTAAEGTFFASGWTKFVQDQALRELDFLVFRHDGGTRFAAMVFDKTACER 127 >ref|XP_002456269.1| hypothetical protein SORBIDRAFT_03g033260 [Sorghum bicolor] gi|241928244|gb|EES01389.1| hypothetical protein SORBIDRAFT_03g033260 [Sorghum bicolor] Length = 390 Score = 59.7 bits (143), Expect = 2e-07 Identities = 37/108 (34%), Positives = 56/108 (51%), Gaps = 12/108 (11%) Frame = -1 Query: 318 FFKVLLPGCFEKRLGLPPHFCI--------EARTEFVEEGVVTTCLG----RWKMSMMEM 175 FFKVL+ G F+KRL +PP FC +A+T E + T G W + + Sbjct: 19 FFKVLM-GDFKKRLKIPPDFCKHIPWEASRKAKTTLKEASMAATLEGPSGRTWLVVIRRS 77 Query: 174 EEIFYFHGCRWERFVKRHDLLVGNFIVFKHDSGMKFSASIFDKSCCEK 31 E +F W +FV+ +L F+VF+HD G F+A +FD + C++ Sbjct: 78 AEGTFFTS-GWPKFVQDQELRELEFLVFRHDGGTHFTAMVFDTTACQR 124