BLASTX nr result
ID: Scutellaria24_contig00009039
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00009039 (691 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274416.1| PREDICTED: uncharacterized protein LOC100248... 81 2e-13 emb|CBI31252.3| unnamed protein product [Vitis vinifera] 81 2e-13 ref|XP_002525513.1| conserved hypothetical protein [Ricinus comm... 79 7e-13 ref|XP_002325507.1| predicted protein [Populus trichocarpa] gi|2... 79 8e-13 ref|XP_002878538.1| predicted protein [Arabidopsis lyrata subsp.... 77 2e-12 >ref|XP_002274416.1| PREDICTED: uncharacterized protein LOC100248156 [Vitis vinifera] Length = 145 Score = 81.3 bits (199), Expect = 2e-13 Identities = 36/48 (75%), Positives = 43/48 (89%) Frame = -2 Query: 651 KHLVFDRRYGLVLDEWKEPSEEALSGGRGMFCIVPIAKALLKKASESV 508 K L+FDRRYG V DEWK+PS+EALSGGRGMFCI+P+A ALLK AS+S+ Sbjct: 23 KRLLFDRRYGWVFDEWKDPSQEALSGGRGMFCILPLATALLKTASQSI 70 >emb|CBI31252.3| unnamed protein product [Vitis vinifera] Length = 143 Score = 81.3 bits (199), Expect = 2e-13 Identities = 36/48 (75%), Positives = 43/48 (89%) Frame = -2 Query: 651 KHLVFDRRYGLVLDEWKEPSEEALSGGRGMFCIVPIAKALLKKASESV 508 K L+FDRRYG V DEWK+PS+EALSGGRGMFCI+P+A ALLK AS+S+ Sbjct: 21 KRLLFDRRYGWVFDEWKDPSQEALSGGRGMFCILPLATALLKTASQSI 68 >ref|XP_002525513.1| conserved hypothetical protein [Ricinus communis] gi|223535192|gb|EEF36871.1| conserved hypothetical protein [Ricinus communis] Length = 77 Score = 79.3 bits (194), Expect = 7e-13 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = -2 Query: 651 KHLVFDRRYGLVLDEWKEPSEEALSGGRGMFCIVPIAKALLKKASES 511 K L++DRRYG V+DEWKEPSEEAL+GGRGMFCI+P++KALL AS S Sbjct: 26 KRLLYDRRYGWVVDEWKEPSEEALAGGRGMFCILPLSKALLNSASHS 72 >ref|XP_002325507.1| predicted protein [Populus trichocarpa] gi|222862382|gb|EEE99888.1| predicted protein [Populus trichocarpa] Length = 137 Score = 79.0 bits (193), Expect = 8e-13 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -2 Query: 645 LVFDRRYGLVLDEWKEPSEEALSGGRGMFCIVPIAKALLKKASESV 508 L+FDRRYG V DEWK+PSEEALSGGRGMFCI+P+AKA L AS+S+ Sbjct: 21 LLFDRRYGWVFDEWKDPSEEALSGGRGMFCILPLAKAFLTTASQSI 66 >ref|XP_002878538.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297324377|gb|EFH54797.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 93 Score = 77.4 bits (189), Expect = 2e-12 Identities = 32/48 (66%), Positives = 42/48 (87%) Frame = -2 Query: 651 KHLVFDRRYGLVLDEWKEPSEEALSGGRGMFCIVPIAKALLKKASESV 508 + L+FDRRYG V+DEWK+PSEEAL+GGRGMFC+VP+ K L + AS+S+ Sbjct: 13 RRLLFDRRYGWVVDEWKDPSEEALAGGRGMFCVVPLTKTLFQTASQSI 60